Swine IL-4 Recombinant Protein (N-His) (active) (RPES6847)
- SKU:
- RPES6847
- Product Type:
- Recombinant Protein
- Species:
- Porcine
- Application Area:
- Cytokines & Chemokines
Frequently bought together:
Description
| Product Name: | Swine IL-4 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6847 |
| Size: | 5µg |
| Species: | Porcine |
| Expression Host: | E.coli |
| Synonyms: | BCGF, BCDF, B-cell Stimulating Factor (BSF-1) |
| Mol Mass: | 15.85 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | Please contact us for more information. |
| Bio Activity: | Measure by its ability to induce proliferation in TF-1 cells. The ED50 for this effect is < 0.6 ng/mL. |
| Sequence: | MGLTSQLIPTLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC |
| Accession: | Q04745 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Interleukin-4 (IL-4) is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation; survival and gene expression. IL-4 is produced by mast cells; T cells; and bone marrow stromal cells. IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells; characterized by their cytokine-secretion profile that includes secretion of IL-4; IL-5; IL-6; IL-10; and IL-13; which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergic response. |