Swine CXCL13 Recombinant Protein (N-His) (RPES6866)
- SKU:
- RPES6866
- Product Type:
- Recombinant Protein
- Species:
- Porcine
- Application Area:
- Cytokines & Chemokines
Frequently bought together:
Description
| Product Name: | Swine CXCL13 Recombinant Protein (N-His) |
| Product Code: | RPES6866 |
| Size: | 5µg |
| Species: | Porcine |
| Expression Host: | E.coli |
| Mol Mass: | 13.32 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | Please contact us for more information. |
| Bio Activity: | Testing in progress |
| Sequence: | MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA |
| Accession: | A0A287A706 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5. |