Mouse VEGF121 Recombinant Protein (N-His) (active)
- SKU:
- RPES6725
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Frequently bought together:
Description
| Product Name: | Mouse VEGF121 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6725 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | Leukocyte Interferon, IFNA2, B cell Interferon, Type I Interferon |
| Mol Mass: | 26.11 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is < 3 ng/mL. |
| Sequence: | MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Accession: | Q00731 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Human VEGF121; also known as Vascular endothelial growth factor A; VEGFA; Vascular permeability factor; VPF and VEGF; is a homodimeric; heparin-binding glycoprotein which belongs to the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family. VEGF-A is a glycosylated mitogen that specifically acts on endothelial cells and has various effects; including mediating increased vascular permeability; inducing angiogenesis; vasculogenesis; permeabilization of blood vessels and endothelial cell growth; increasing microvascular permeability; promoting cell migration and inhibiting apoptosis. Alternatively spliced transcript variants of VEGF-A encod either secreted or cell-associated isoforms. The lymphangiogenesis may be promoted by upregulation of VEGF121; which may in turn act in part via induction of VEGF-C. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors; heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways; does not activate angiogenesis and inhibits tumor growth. |