Human IL-28B Recombinant Protein (N-His) (active)
- SKU:
- RPES6422
- Product Type:
- Recombinant Protein
- Species:
- Human
Frequently bought together:
Description
| Product Name: | Human IL-28B Recombinant Protein (N-His) (active) |
| Product Code: | RPES6422 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | interferon lambda 3, IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28C, IL28C |
| Mol Mass: | 22.53 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.01 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 5 ng/mL. |
| Sequence: | MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV |
| Accession: | Q8IZI9 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Interleukin-28B; also known as Cytokine Zcyto22; Interferon lambda-3; Interferon lambda-4; IFNL3; IFNL4; ZCYTO22 and IL28B; is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition; IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. |