SUR2A Antibody [N319A/14 (Formerly sold as S319A-14)]
SUR2A Antibody [N319A/14 (Formerly sold as S319A-14)] is a mouse monoclonal antibody directed against SUR2A, offered by Assay Genie for research applications. Reported applications include WB, IHC and ICC/IF. Reported reactivity: Human, Mouse and Rat. Supplied as IgG2A, purified by Protein G.
Sulfonylurea receptor 2A (SUR2A), encoded by the ABCC9 gene, is a regulatory subunit of ATP-sensitive potassium (KATP) channels, which serve as metabolic sensors linking cellular energy status to membrane excitability. SUR2A partners with Kir6.1 or Kir6.2 subunits to form functional KATP channels, which open or close in response to intracellular ATP and ADP levels. This dynamic regulation allows cells to adapt to metabolic stress by modulating ion flux and electrical activity. While SUR2A is well-characterized in cardiac and skeletal muscle, its emerging role in the central nervous system is gaining attention. In neurons and glial cells, SUR2A-containing KATP channels help maintain ionic homeostasis, protect against excitotoxicity, and support mitochondrial function under stress conditions. These properties are particularly relevant in the context of neurodegenerative diseases, where energy failure, oxidative stress, and inflammation contribute to progressive neuronal loss. Recent studies suggest that SUR2A may influence neurovascular coupling, blood-brain barrier integrity, and neuronal survival pathways—making it a promising target for therapeutic intervention in disorders such as Alzheimer’s disease, Parkinson’s disease, and stroke. Modulating SUR2A activity could offer neuroprotective benefits by enhancing cellular resilience to metabolic and oxidative insults. Understanding the role of SUR2A in brain metabolism and neuroprotection is critical for advancing novel strategies in neurodegenerative disease research. This antibody is also available conjugated to ATTO 390, ATTO 488, ATTO 594, APC, Biotin, FITC, HRP, PerCP and RPE. Supplied in 100 µg. For research use only; not for diagnostic or therapeutic procedures.
Product Name:
SUR2A Antibody [N319A/14 (Formerly sold as S319A-14)]
Product SKU:
STMA00136
Size:
100 µg
Target:
SUR2A
Host Species:
Mouse
Antibody Type:
Monoclonal
Clone ID:
N319A/14 (Formerly sold as S319A-14)
Research Areas:
Neuroscience, Cell Markers, Neuron Markers, Membrane Markers, Cell Signaling, Cancer
Buffer:
PBS pH7.4, 50% glycerol, 0.1% sodium azide
Storage & Shipping:
Store at -20°C. Shipped on Blue Ice or 4°C. Conjugated variants should be stored according to the product label.
Format:
Liquid
Applications:
WB, IHC, ICC/IF
Antibody Isotype:
IgG2A
Purification:
Protein G Purified
Concentration:
1 mg/ml
Reactivity:
Human, Mouse, Rat
Recommended Dilution:
WB (1:1000); optimal dilutions for assays should be determined by the user.
Specificity:
Detects ~120kDa. Does not cross-react with SUR2B.
Guarantee:
12 months from date of dispatch
Immunogen:
Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A
Immunogen Species:
Mouse
Accession Number:
NP_001038185.1
Gene ID:
1957-04-18 00:00:00
Swiss-Prot:
P70170
Cellular Localization:
Membrane
Alternative Names:
ABCC9, Sulfonylurea receptor 2, CMD10, ABC37, ATP-binding cassette transporter sub-family C member 9, Sulfonylurea receptor 2A, isoform SUR2A
Synaptotagmin-7 Antibody [N275/14 (Formerly sold as S275-14)]Synaptotagmin-7 Antibody [N275/14 (Formerly sold as S275-14)] is a mouse monoclonal antibody directed against Synaptotagmin-7, offered by...
Sulfotyrosine Antibody [12B11 (Formerly sold as 7C5)]Sulfotyrosine Antibody [12B11 (Formerly sold as 7C5)] is a mouse recombinant monoclonal antibody directed against Sulfotyrosine, offered by Assay...
Stargazin Antibody [N245/36 (Formerly sold as S245-36)]Stargazin Antibody [N245/36 (Formerly sold as S245-36)] is a mouse monoclonal antibody directed against Stargazin, offered by Assay Genie for...
TRPC7 Antibody [N64A/36 (Formerly sold as S64A-36)]TRPC7 Antibody [N64A/36 (Formerly sold as S64A-36)] is a mouse monoclonal antibody directed against TRPC7, offered by Assay Genie for research...
MMP9 Antibody [L51/82 (Formerly sold as S51-82)]MMP9 Antibody [L51/82 (Formerly sold as S51-82)] is a mouse monoclonal antibody directed against MMP9, offered by Assay Genie for research applications...