Swine IL-1 beta Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6845
Product Type:
Recombinant Protein
Species:
Porcine

Description

Product Name:Swine IL-1 beta Recombinant Protein (N-His) (active)
Product Code:RPES6845
Size:5µg
Species:Porcine
Expression Host:E.coli
Synonyms:IL1B1, IL1B
Mol Mass:31.23 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:Please contact us for more information.
Bio Activity:Measure by its ability to induce D10.G4. 1 cells proliferation. The ED50 for this effect is 3 ng/mL.
Sequence:MAIVPEPAKEVMANYGDNNNDLLFEADGPKEMKCCTQNLDLGSLRNGSIQLQISHQLWNKSIRQMVSVIVAVEKPMKNPSSQAFCDDDQKSIFSFIFEEEPIILETCNDDFVCDANVQSMECKLQDKDHKSLVLAGPHMLKALHLLTGDLKREVVFCMSFVQGDDSNNKIPVTLGIKGKNLYLSCVMKDNTPTLQLEDIDPKRYPKRDMEKRFVFYKTEIKNRVEFESALYPNWYISTSQAEQKPVFLGNSKGRQDITDFTMEVLSP
Accession:P26889
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family. IL1 is a pleiotropic cytokine. It is involved in the inflammatory response, cell growth, and tissue repair in the cortex. The IL1 superfamily consists of three members, IL1A (IL1 alpha), IL1B (IL1 beta), and IL1 receptor antagonist (IL1Ra). In clinical, it has been reported that Interleukin (IL)-1 may influence Th1 / Th2 immune responsiveness and has been implicated in the establishment of successful pregnancy. Proinflammatory interleukin (IL)-1 gene polymorphisms associated with high levels of IL-1beta activity increase the risk for hypochlorhydria and distal gastric carcinoma. IL1B polymorphisms may be involved in susceptibility to SSc. Moreover, the IL2-384-G allele may be a marker for the limited phenotype of systemic sclerosis (SSc).
View AllClose

0 Reviews

View AllClose

Related Products