Name: Swine IFN gamma Recombinant Protein (N-His) (active)
SKU: RPES6855
Availability: OutOfStock

Swine IFN gamma Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

SKU:

RPES6855

Product Type:

Recombinant Protein

Species:

Porcine

Description

View AllClose

0 Reviews

View AllClose

OverviewProduct Name:Swine CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6862Size:5µgSpecies:Porcine<

OverviewProduct Name:Swine FGF-2 Recombinant Protein (N-His) (active)Product Code:RPES6859Size:5µgSpecies:Porcine

OverviewProduct Name:Swine IL-6 Recombinant Protein (N-His) (active)Product Code:RPES6848Size:5µgSpecies:Porcine

OverviewProduct Name:Swine IL-2 Recombinant Protein (N-His) (active)Product Code:RPES6846Size:5µgSpecies:Porcine

OverviewProduct Name:Swine TNF alpha Recombinant Protein (N-His) (active)Product Code:RPES6853Size:5ÃÂµgSpecies:Porcine

Mol Mass:	20.25 kDa
Tag:	N-His
Purity:	> 95 % as determined by reducing SDS-PAGE.
Endotoxin Level:	Please contact us for more information.
Bio Activity:	Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 40 pg/mL.

Sequence:	MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK
Accession:	P17803
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them; leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens; mitogens; or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2; FGF-basic; and EGF.