Swine IFN gamma Recombinant Protein (N-His) (active)
- SKU:
- RPES6855
Description
| Product Name: | Swine IFN gamma Recombinant Protein (N-His) (active) |
| Product Code: | RPES6855 |
| Size: | 5µg |
| Species: | Porcine |
| Expression Host: | E.coli |
| Mol Mass: | 20.25 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | Please contact us for more information. |
| Bio Activity: | Measure by its ability to protect PK15 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 40 pg/mL. |
| Sequence: | MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK |
| Accession: | P17803 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them; leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens; mitogens; or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2; FGF-basic; and EGF. |
Related Products
Swine CXCL10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6862Size:5µgSpecies:Porcine<
Swine IL-15 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine IL-15 Recombinant Protein (N-His) (active)Product Code:RPES6851Size:5µgSpecies:Porcine
Swine IL-4 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine IL-4 Recombinant Protein (N-His) (active)Product Code:RPES6847Size:5µgSpecies:Porcine
Swine TNF alpha Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine TNF alpha Recombinant Protein (N-His) (active)Product Code:RPES6853Size:5õgSpecies:Porcine
Swine FGF-2 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine FGF-2 Recombinant Protein (N-His) (active)Product Code:RPES6859Size:5µgSpecies:Porcine