Swine FGF-2 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6859
Product Type:
Recombinant Protein
Species:
Porcine

Description

Product Name:Swine FGF-2 Recombinant Protein (N-His) (active)
Product Code:RPES6859
Size:5µg
Species:Porcine
Expression Host:E.coli
Synonyms:Fgfb, bFGF, FGF-basic
Mol Mass:18.07 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:Please contact us for more information.
Bio Activity:Measure by its ability to induce proliferation in 3T3 cells. The ED50 for this effect is < 2 ng/mL.
Sequence:MAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHI KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKY SSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Accession:P03969
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from a solution containing 0.01% sarkosyl in 1X PBS, pH 7.4. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual
Reconstitution:Please refer to the printed manual for detailed information.
Background:Fibroblast growth factor 2(FGF2) is a secreted protein and belongs to the heparin-binding growth factors family. FGF2 is produced by epithelial; tumor and other cell types. It involved in developmental processes and regulates differentiation; proliferation; and migration; FGF2 is a critical factor for growing embryonic stem cells in culture without inducing differentiation. FGF2 has a high affinity for heparan sulfate and binding is a step in the FGF basic activation of FGFR tyrosine kinase.
View AllClose

0 Reviews

View AllClose

Related Products