Name: Swine CXCL13 Recombinant Protein (N-His)
SKU: RPES6866
Availability: OutOfStock

Swine CXCL13 Recombinant Protein (N-His)

(No reviews yet) Write a Review

SKU:

RPES6866

Product Type:

Recombinant Protein

Species:

Porcine

Description

View AllClose

0 Reviews

View AllClose

OverviewProduct Name:Human CXCL13 Recombinant Protein (N-His) (active)Product Code:RPES6505Size:20µgSpecies:Human

OverviewProduct Name:Swine CXCL11 Recombinant Protein (N-His)Product Code:RPES6865Size:5µgSpecies:PorcineExpres

OverviewProduct Name:Swine CXCL9 Recombinant Protein (N-His)Product Code:RPES6864Size:5µgSpecies:PorcineExpress

OverviewProduct Name:Swine CCL2 Recombinant Protein (N-His)Product Code:RPES6861Size:5µgSpecies:PorcineExpressi

OverviewProduct Name:Swine EGF Recombinant Protein (N-His)Product Code:RPES6858Size:100µgSpecies:PorcineExpress

Mol Mass:	13.32 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	Please contact us for more information.
Bio Activity:	Testing in progress

Sequence:	MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA
Accession:	A0A287A706
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B-lymphocytes. Binds to BLR1/CXCR5.