Cytokines Recombinant Proteins
Rat IL 1 beta Recombinant Protein (RPPB0461)
- SKU:
- RPPB0461
- Product Type:
- Recombinant Protein
- Species:
- Rat
- Uniprot:
- Q63264
- Research Area:
- Cytokines
Description
| Product Name: | Rat IL 1 beta Recombinant Protein |
| Product Code: | RPPB0461 |
| Size: | 10µg |
| Species: | Rat |
| Target: | IL 1 beta |
| Synonyms: | Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The protein was lyophilized from 0.2um filtered concentrated solution in PBS, pH 7.4. |
| Solubility: | It is recommended to reconstitute the lyophilized Interleukin 1b in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized Interleukin-1b although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL1b should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 97.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MVPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTLQLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS |
| Biological Activity: | The ED50 was found to be less than 0.1ng/ml, determined by the dose dependent proliferation of mouse D10S cells, corresponding to a specific activity of 10,000,000 units/mg. |
Interleukin-1b is produced by activated macrophages, IL-1B stimulates thymocyte proliferation by inducing il-2 release, b-cell maturation and proliferation, and fibroblast growth factor activity. IL1B proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin from synovial cells.
Interleukin-1b Rat Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 153 amino acids and having a molecular mass of 17.3 kDa.The IL-1b is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | IL1B: Produced by activated macrophages, IL-1 stimulates thymocyte proliferation by inducing IL-2 release, B-cell maturation and proliferation, and fibroblast growth factor activity. IL-1 proteins are involved in the inflammatory response, being identified as endogenous pyrogens, and are reported to stimulate the release of prostaglandin and collagenase from synovial cells. Monomer. Belongs to the IL-1 family. |
| UniProt Protein Details: | Protein type:Cytokine Cellular Component: extracellular space; extracellular region; vesicle; secretory granule Molecular Function:protein domain specific binding; interleukin-1 receptor binding; cytokine activity Biological Process: positive regulation of granulocyte macrophage colony-stimulating factor production; negative regulation of MAP kinase activity; positive regulation of JNK activity; positive regulation of nitric oxide biosynthetic process; negative regulation of glutamate secretion; glycoprotein metabolic process; positive regulation of apoptosis; activation of MAPK activity; positive regulation of transcription, DNA-dependent; positive regulation of interleukin-2 biosynthetic process; response to glucocorticoid stimulus; germ cell programmed cell death; negative regulation of insulin receptor signaling pathway; positive regulation of glial cell differentiation; positive regulation of NF-kappaB import into nucleus; response to lipopolysaccharide; positive regulation of lipid catabolic process; fever; positive regulation of membrane protein ectodomain proteolysis; response to organic cyclic substance; response to carbohydrate stimulus; activation of NF-kappaB transcription factor; elevation of cytosolic calcium ion concentration; response to vitamin D; pentacyclic triterpenoid metabolic process; positive regulation of phagocytosis; positive regulation of T cell proliferation; positive regulation of astrocyte differentiation; response to drug; neutrophil chemotaxis; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of heterotypic cell-cell adhesion; positive regulation of mitosis; positive regulation of interleukin-6 production; interleukin-1 beta production; social behavior; response to organic nitrogen; purine base metabolic process; positive regulation of angiogenesis; negative regulation of neuron differentiation; response to ethanol; response to heat; positive regulation of cell division; positive regulation of transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; negative regulation of lipid metabolic process; leukocyte migration; response to peptide hormone stimulus; estrogen metabolic process; sequestering of triacylglycerol; wound healing; positive regulation of interleukin-6 biosynthetic process; response to morphine; positive regulation of JNK cascade; negative regulation of transcription from RNA polymerase II promoter; response to L-ascorbic acid; chronic inflammatory response to antigenic stimulus; positive regulation of stress-activated MAPK cascade; response to estradiol stimulus; negative regulation of neurogenesis; positive regulation of interleukin-8 production; negative regulation of cell proliferation; learning and/or memory; negative regulation of lipid catabolic process; hyaluronan biosynthetic process; protein kinase B signaling cascade; lipopolysaccharide-mediated signaling pathway; response to gamma radiation; regulation of I-kappaB kinase/NF-kappaB cascade; inflammatory response; response to nutrient; aging; cytokine and chemokine mediated signaling pathway; MAPKKK cascade; positive regulation of immature T cell proliferation in the thymus; response to ATP; memory; ovulation; polyketide metabolic process; positive regulation of interferon-gamma production; positive regulation of chemokine biosynthetic process; response to ozone; positive regulation of prostaglandin secretion; response to hypoxia; positive regulation of fever; immune response; positive regulation of protein amino acid phosphorylation; regulation of insulin secretion |
| NCBI Summary: | an inflammatory cytokine [RGD, Feb 2006] |
| UniProt Code: | Q63264 |
| NCBI GenInfo Identifier: | 2497335 |
| NCBI Gene ID: | 24494 |
| NCBI Accession: | Q63264.1 |
| UniProt Related Accession: | Q63264 |
| Molecular Weight: | 30,644 Da |
| NCBI Full Name: | Interleukin-1 beta |
| NCBI Synonym Full Names: | interleukin 1 beta |
| NCBI Official Symbol: | Il1b�� |
| NCBI Protein Information: | interleukin-1 beta; IL-1 beta |
| UniProt Protein Name: | Interleukin-1 beta |
| Protein Family: | Interleukin |
| UniProt Gene Name: | Il1b�� |
| UniProt Entry Name: | IL1B_RAT |
Related Products
Rat IL beta/IL1B Recombinant Protein (RPES3892)
Growth Factors & Cytokines Recombinant Proteins
Mouse IL 1 beta Recombinant Protein (RPPB0458)
Cytokines Recombinant Proteins
