Mouse VEGF121 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6725
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse VEGF121 Recombinant Protein (N-His) (active)
Product Code:RPES6725
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:Leukocyte Interferon, IFNA2, B cell Interferon, Type I Interferon
Mol Mass:26.11 kDa
Tag:N-His
Purity:> 95 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is < 3 ng/mL.
Sequence:MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Accession:Q00731
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Human VEGF121; also known as Vascular endothelial growth factor A; VEGFA; Vascular permeability factor; VPF and VEGF; is a homodimeric; heparin-binding glycoprotein which belongs to the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family. VEGF-A is a glycosylated mitogen that specifically acts on endothelial cells and has various effects; including mediating increased vascular permeability; inducing angiogenesis; vasculogenesis; permeabilization of blood vessels and endothelial cell growth; increasing microvascular permeability; promoting cell migration and inhibiting apoptosis. Alternatively spliced transcript variants of VEGF-A encod either secreted or cell-associated isoforms. The lymphangiogenesis may be promoted by upregulation of VEGF121; which may in turn act in part via induction of VEGF-C. It binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors; heparan sulfate and heparin. NRP1/Neuropilin-1 binds isoforms VEGF-165 and VEGF-145. Isoform VEGF165B binds to KDR but does not activate downstream signaling pathways; does not activate angiogenesis and inhibits tumor growth.
View AllClose

0 Reviews

View AllClose

Related Products