Mouse IL-9 Recombinant Protein (N-His) (active) (RPES6698)

(No reviews yet) Write a Review
SKU:
RPES6698
Product Type:
Recombinant Protein
Species:
Mouse
Application Area:
Cytokines & Chemokines
Frequently bought together:

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Mouse IL-9 Recombinant Protein (N-His) (active)
Product Code:RPES6698
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:Interleukin-12 subunit beta, IL-12 subunit p40, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40), NK cell Stimulating Factor Chain 2
Mol Mass:16.90 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106IU/mg.
Sequence:MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP
Accession:P15247
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.
View AllClose

0 Reviews

View AllClose

Related Products