Mouse IL-9 Recombinant Protein (N-His) (active)
- SKU:
- RPES6698
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
| Product Name: | Mouse IL-9 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6698 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | Interleukin-12 subunit beta, IL-12 subunit p40, IL-12B, Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40), NK cell Stimulating Factor Chain 2 |
| Mol Mass: | 16.90 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-9 is > 5 x 106IU/mg. |
| Sequence: | MLVTYILASVLLFSSVLGQRCSTTWGIRDTNYLIENLKDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP |
| Accession: | P15247 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness. |
Related Products
Mouse IL-5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-5 Recombinant Protein (N-His) (active)Product Code:RPES6684Size:20µgSpecies:Mouse
Mouse IL-30 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-30 Recombinant Protein (N-His) (active)Product Code:RPES6699Size:20µgSpecies:Mouse
Mouse IL-3 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-3 Recombinant Protein (N-His) (active)Product Code:RPES6683Size:20µgSpecies:Mouse
Mouse IL-15 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-15 Recombinant Protein (N-His) (active)Product Code:RPES6689Size:20µgSpecies:Mouse
Mouse IL-36RA Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-36RA Recombinant Protein (N-His) (active)Product Code:RPES6705Size:20õgSpecies:Mouse