Mouse IL-28B Recombinant Protein (N-His) (active)
- SKU:
- RPES6697
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
| Product Name: | Mouse IL-28B Recombinant Protein (N-His) (active) |
| Product Code: | RPES6697 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | Interleukin-12 subunit alpha, IL-12 subunit p35, IL-12A, Cytotoxic Lymphocyte Maturation Factor 35 kDa |
| Mol Mass: | 22.49 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 20 ng/mL. |
| Sequence: | MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKGAIEKRLLEKDMRCSSHLISRAWDLKQLQVQERPKALQAEVALTLKVWENINDSALTTILGQPLHTLSHIHSQLQTCTQLQATAEPKPPSRRLSRWLHRLQEAQSKETPGCLEDSVTSNLFQLLLRDLKCVASGDQCV |
| Accession: | Q8CGK6 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Interleukin-28B; also known as Cytokine Zcyto22; Interferon lambda-3; Interferon lambda-4; IFNL3; IFNL4; ZCYTO22 and IL28B; is a secreted cytokine which belongs to the IL-28/IL-29 family. IL-28 has also been shown to play a role in the adaptive immune response. IL28B has immunomodulatory activity and up-regulates MHC class I antigen expression. IL28B displays potent antiviral activity and antitumor activity. In addition; IL28B is a ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. |
Related Products
Human IL-28B Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-28B Recombinant Protein (N-His) (active)Product Code:RPES6422Size:20µgSpecies:Human
Mouse IL-5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-5 Recombinant Protein (N-His) (active)Product Code:RPES6684Size:20µgSpecies:Mouse
Mouse IL-30 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-30 Recombinant Protein (N-His) (active)Product Code:RPES6699Size:20µgSpecies:Mouse
Mouse IL-3 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-3 Recombinant Protein (N-His) (active)Product Code:RPES6683Size:20µgSpecies:Mouse
Mouse IL-15 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-15 Recombinant Protein (N-His) (active)Product Code:RPES6689Size:20µgSpecies:Mouse