Description
| Product Name: | Mouse CXCL7 (48-109) Recombinant Protein (N-His) (active) |
| Product Code: | RPES6739 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | AI462269 |
| Mol Mass: | 13.08 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 5 ng/mL. |
| Sequence: | MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY |
| Accession: | Q9EQI5 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Human Chemokine (C-X-C motif) Ligand 7 (CXCL7); also known as neutrophil activating peptide 2 (NAP-2); is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif). Similar to other ELR domain containing CXC chemokines; such as IL-8 and the GRO proteins; CXCL7 binds CXCR2; chemoattracts and activates neutrophils. CXCL7; Connective Tissue Activating Protein III (CTAPIII) and βthrombogulin (βTG); are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII; βTG; and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains; these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2. |