Mouse CXCL10 Recombinant Protein (N-His) (active)
- SKU:
- RPES6726
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
| Product Name: | Mouse CXCL10 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6726 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | IFNB1, Type I Interferon |
| Mol Mass: | 8.7 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR3. The ED50 for this effect is < 0.2 μg/mL. |
| Sequence: | IPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKNDEQRCLNPESKTIKNLMKAFSQKRSKRAP |
| Accession: | P17515 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Human C-X-C Motif Chemokine Ligand 10 (CXCL10) is a non-ELR chemokine secreted by various cell types; such as monocytes; endothelial cells and fibroblasts; in response to IFN-γ. CXCL10 functions via chemokine receptor CXCR3. CXCL10 has been attributed to several roles; such as chemoattraction for activated T-lymphocytes; inhibition of angiogenesis; and antitumor activity. |
Related Products
Swine CXCL10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6862Size:5µgSpecies:Porcine<
Mouse CXCL3 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL3 Recombinant Protein (N-His) (active)Product Code:RPES6731Size:20µgSpecies:Mouse
Mouse CXCL16 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL16 Recombinant Protein (N-His) (active)Product Code:RPES6743Size:20µgSpecies:Mouse
Mouse CXCL5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL5 Recombinant Protein (N-His) (active)Product Code:RPES6732Size:20µgSpecies:Mouse
Mouse CCL2 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CCL2 Recombinant Protein (N-His) (active)Product Code:RPES6727Size:20µgSpecies:Mouse