Human TPO Recombinant Protein (N-His) (active)
- SKU:
- RPES6476
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human TPO Recombinant Protein (N-His) (active) |
| Product Code: | RPES6476 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | Megakaryocyte colony-stimulating factor, c-MPL Ligand, MGDF |
| Mol Mass: | 38.65 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.01 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 2 ng/mL. The specific activity of recombinant human TPO is > 5 x 105IU/mg. |
| Sequence: | MELTELLLVVMLLLTARLTLSSPAPPACDLRVLSKLLRDSHVLHSRLSQCPEVHPLPTPVLLPAVDFSLGEWKTQMEETKAQDILGAVTLLLEGVMAARGQLGPTCLSSLLGQLSGQVRLLLGALQSLLGTQLPPQGRTTAHKDPNAIFLSFQHLLRGKVRFLMLVGGSTLCVRRAPPTTAVPSRTSLVLTLNELPNRTSGLLETNFTASARTTGSGLLKWQQGFRAKIPGLLNQTSRSLDQIPGYLNRIHELLNGTRGLFPGPSRRTLGAPDISSGTSDTGSLPPNLQPGYSPSPTHPPTGQYTLFPLPPTLPTPVVQLHPLLPDPSAPTPTPTSPLLNTSYTHSQNLSQEG |
| Accession: | P40225 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Thrombopoietin (TPO) is a glycoprotein hormone which belongs to the EPO/TPO family. It produced by the liver and kidney which regulates the production of platelets. TPO stimulates the production and differentiation of megakaryocytes, the bone marrow cells that bud off large numbers of platelets. Lineage-specific cytokine affects the proliferation and maturation of megakaryocytes from their committed progenitor cells. It acts at a late stage of megakaryocyte development. It may be the major physiological regulator of circulating platelets. |
Related Products
Human CD27L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD27L Recombinant Protein (N-His) (active)Product Code:RPES6430Size:20µgSpecies:Human
Human TWEAK Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TWEAK Recombinant Protein (N-His) (active)Product Code:RPES6436Size:20µgSpecies:Human
Human LIGHT, Human Recombinant Protein (N-His) (active)
OverviewProduct Name:Human LIGHT, Human Recombinant Protein (N-His) (active)Product Code:RPES6433Size:20µgSpecies:Human
Human FasL Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FasL Recombinant Protein (N-His) (active)Product Code:RPES6432Size:20µgSpecies:Human
Human CXCL11 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL11 Recombinant Protein (N-His) (active)Product Code:RPES6504Size:20µgSpecies:Human
Human CXCL9 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL9 Recombinant Protein (N-His) (active)Product Code:RPES6503Size:20µgSpecies:Human
Human CXCL4 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL4 Recombinant Protein (N-His) (active)Product Code:RPES6501Size:20µgSpecies:Human
Human VEGF165 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human VEGF165 Recombinant Protein (N-His) (active)Product Code:RPES6434Size:20µgSpecies:Human<
Human CXCL6 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL6 Recombinant Protein (N-His) (active)Product Code:RPES6502Size:20µgSpecies:Human