Human CCL4 Recombinant Protein (N-His) (active) (RPES6478)
- SKU:
- RPES6478
- Product Type:
- Recombinant Protein
- Species:
- Human
- Application Area:
- Cytokines & Chemokines
Frequently bought together:
Description
| Product Name: | Human CCL4 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6478 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2 |
| Mol Mass: | 11.04 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to chemoattract BaF3 cells transfected with human CCR5. The ED50 for this effect is < 10 ng/mL. |
| Sequence: | MKLCVTVLSLLMLVAAFCSPALSAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN |
| Accession: | P13236 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manu |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | CCL4 (C-C chemokine ligand 4), is a macrophage inflammatory protein with a chief effect in inflammation and immune-regulation, and was documented in cancer progression by promoting instability in the tumor environment. The inflammatory chemokine (C-C motif) ligand 4 (CCL4) plays an important role in the pathogenesis and progression of cancer. In particular, higher serum CCL4 levels in patients with oral squamous cell carcinoma (OSCC) are associated with a more advanced stage of disease. CCL4 may be a new molecular therapeutic target for inhibition of lymphangiogenesis and metastasis in OSCC. CCL3 and CCL4 loci may be marker SNPs for risk of HCV treatment outcome. CCL4 can enhance the recruitment of preosteoclasts to bone in the early stage, and the reduction of CCR5 promotes osteoclastogenesis when RANKL is prevalent. |