Name: Human IL-9 Recombinant Protein (N-His) (active)
SKU: RPES6410
Availability: OutOfStock

Human IL-9 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

SKU:

RPES6410

Product Type:

Recombinant Protein

Species:

Human

Description

View AllClose

0 Reviews

View AllClose

OverviewProduct Name:Human IL-28A Recombinant Protein (N-His) (active)Product Code:RPES6421Size:20µgSpecies:Human

OverviewProduct Name:Human IL-19 Recombinant Protein (N-His) (active)Product Code:RPES6415Size:20µgSpecies:Human

OverviewProduct Name:Human IL-29 Recombinant Protein (N-His) (active)Product Code:RPES6423Size:20µgSpecies:Human

OverviewProduct Name:Human IL-25 Recombinant Protein (N-His) (active)Product Code:RPES6419Size:20µgSpecies:Human

OverviewProduct Name:Human IL-26 Recombinant Protein (N-His) (active)Product Code:RPES6420Size:20µgSpecies:Human

Mol Mass:	16.73 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.01 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to induce proliferation in MO7e cells. The ED50 for this effect is < 0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately > 5 x106 IU/ mg.

Sequence:	MLLAMVLTSALLLCSVAGQGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI
Accession:	P15248
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	Interleukin-9 (IL-9) is a secreted protein that belongs to the IL-7/IL-9 family.Mature mouse IL-9 shares 57% and 74% amino acid sequence identity with human and rat IL-9, respectively. IL-9 supports IL-2 independent and IL-4 independent growth of helper T-cells. IL-9 stimulates cell proliferation and prevents apoptosis. It functions through the IL-9 receptor (IL-9R), which activates different signal transducer and activator (STAT) proteins and thus connects this cytokine to various biological processes. IL-9 has been identified as a candidate gene for asthma. IL-9 is a determining factor in the pathogenesis of bronchial hyperresponsiveness.