Human IL-24 Recombinant Protein (N-His) (active)
- SKU:
- RPES6418
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human IL-24 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6418 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | MDA-7 (Melanoma Differentiation-Associated gene 7 protein) |
| Mol Mass: | 24.65 kDa |
| Tag: | N-His |
| Purity: | > 95 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to chemoattract BaF3 cells transfected with human IL-20R alpha and IL-20R beta. The ED50 for this effect is < 100 pg/mL. |
| Sequence: | MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL |
| Accession: | Q13007 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Multifunctional cytokine mainly produced by T-cells that plays a regulatory role in immune response, tissue homeostasis, host defense, and oncogenesis. Possesses antiviral functions and induces the type I intereferon response during influenza infection. Signals through two receptor complexes IL20RA/IL20RB or IL20RB/IL22RA1. In turn, stimulates the JAK1-STAT3 and MAPK pathways and promotes the secretion of pro-inflammatory mediators including IL8 and MMP1. Intracellularly, maintains endoplasmic reticulum homeostasis by restricting the eIF2alpha-CHOP pathway-mediated stress signal. In addition, acts as a quality control mechanism for the ubiquitin proteasome system by alerting the cell to proteasome dysfunction through activation of PKR/EIF2AK2. |
Related Products
Human IL-28A Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-28A Recombinant Protein (N-His) (active)Product Code:RPES6421Size:20µgSpecies:Human
Human IL-19 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-19 Recombinant Protein (N-His) (active)Product Code:RPES6415Size:20µgSpecies:Human
Human IL-5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-5 Recombinant Protein (N-His) (active)Product Code:RPES6409Size:20µgSpecies:Human
Human IL-28B Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-28B Recombinant Protein (N-His) (active)Product Code:RPES6422Size:20µgSpecies:Human
Human IL-9 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human IL-9 Recombinant Protein (N-His) (active)Product Code:RPES6410Size:20µgSpecies:Human