Human FasL Recombinant Protein (N-His) (active)
- SKU:
- RPES6432
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human FasL Recombinant Protein (N-His) (active) |
| Product Code: | RPES6432 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | soluble Fas Ligand (sFasL), TNFSF6, CD95L, Apo I Ligand, APTL, APT1LG1, CD178 |
| Mol Mass: | 32.31 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce apoptosis in Jurkat cells. The ED50 for this effect is < 1 ng/mL. The specific activity of recombinant human FasL is > 1 x 106IU/mg. |
| Sequence: | MQQPFNYPYPQIYWVDSSASSPWAPPGTVLPCPTSVPRRPGQRRPPPPPPPPPLPPPPPPPPLPPLPLPPLKKRGNHSTGLCLLVMFFMVLVALVGLGLGMFQLFHLQKELAELRESTSQMHTASSLEKQIGHPSPPPEKKELRKVAHLTGKSNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNLPLSHKVYMRNSKYPQDLVMMEGKMMSYCTTGQMWARSSYLGAVFNLTSADHLYVNVSELSLVNFEESQTFFGLYKL |
| Accession: | P48023 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Fas Ligand, also known as FASLG and CD95L, is the ligand for FAS. It is a transmembrane protein which binds to TNFRSF6/FAS. Interaction of FAS with fas Ligand is critical in triggering apoptosis of some types of cells such as lymphocytes. Fas Ligand may be involved in cytotoxic T-cell mediated apoptosis and in T-cell development. TNFRSF6/FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. |
Related Products
Mouse FasL Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse FasL Recombinant Protein (N-His) (active)Product Code:RPES6709Size:20µgSpecies:Mouse
Human LIGHT, Human Recombinant Protein (N-His) (active)
OverviewProduct Name:Human LIGHT, Human Recombinant Protein (N-His) (active)Product Code:RPES6433Size:20µgSpecies:Human
Human CD326 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD326 Recombinant Protein (N-His) (active)Product Code:RPES6488Size:20µgSpecies:Human
Human CD30L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD30L Recombinant Protein (N-His) (active)Product Code:RPES6431Size:20µgSpecies:Human
Human CNTF Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CNTF Recombinant Protein (N-His) (active)Product Code:RPES6484Size:20µgSpecies:Human