Swine TNF alpha Recombinant Protein (N-His) (active)
- SKU:
- RPES6853
- Product Type:
- Recombinant Protein
- Species:
- Porcine
Description
| Product Name: | Swine TNF alpha Recombinant Protein (N-His) (active) |
| Product Code: | RPES6853 |
| Size: | 5õg |
| Species: | Porcine |
| Expression Host: | E.coli |
| Synonyms: | TNFSF2, Cachectin, Differentiation-inducing factor (DIF), Necrosin, Cytotoxin, TNS_x0002_F1A |
| Mol Mass: | 26.08 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | Please contact us for more information. |
| Bio Activity: | Measure by its ability to induce cytotoxicity in cells in the presence of the actinomycin D. The ED50 for this effect is < 15 pg/mL. |
| Sequence: | MSTESMIRDVELAEEALAKKAGGPQGSRRCLCLSLFSFLLVAGATTLFCLLHFEVIGPQKEEFPAGPLSINPLAQGLRSSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL |
| Accession: | P23563 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Tumor necrosis factor alpha (TNFñ) is the prototypic ligand of the TNF superfamily. TNFñ forms a homotrimer and functions by activating two types of receptors TNF-R1 (TNF receptor type 1,p55R) and TNF-R2 (TNF receptor type 2,p75R). TNFñ is a pleiotropic cytokine that is capable to promote inflammation, to induce apoptotic cell death, and to inhibit tumorigenesis and viral replication. TNFñ is a potent lymphoid factor that exerts cytotoxic effects on a wide range of tumor cells and certain other target cells. |
Related Products
Swine IL-1 alpha Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine IL-1 alpha Recombinant Protein (N-His) (active)Product Code:RPES6844Size:5µgSpecies:Porcine<
Swine CXCL10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6862Size:5µgSpecies:Porcine<
Swine FGF-2 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine FGF-2 Recombinant Protein (N-His) (active)Product Code:RPES6859Size:5µgSpecies:Porcine
Swine IL-6 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine IL-6 Recombinant Protein (N-His) (active)Product Code:RPES6848Size:5µgSpecies:Porcine
Swine IL-2 Recombinant Protein (N-His) (active)
OverviewProduct Name:Swine IL-2 Recombinant Protein (N-His) (active)Product Code:RPES6846Size:5µgSpecies:Porcine