Recombinant Porcine TNF alpha Protein (KPRT0053)
- SKU:
- KPRT0053
- Product Type:
- Recombinant Protein
- Species:
- Pig
Description
Recombinant Porcine TNF alpha Protein (KPRT0053)
| Product SKU | KPRT0053 |
| Product Type | Recombinant Protein |
| Quantity | 5 ug |
| Species | Porcine |
| Target | TNF alpha |
| Alias | TNFSF2; TNF; DIF; TNF-alpha; TNFA; TNFSF2; TNLG1F; TNF alpha |
| Source | Yeast |
| No. Amino Acids | 154 |
| Protein Sequence | SSSQTSDKPVAHVVANVKAEGQLQWQSGYANALLANGVKLKDNQLVVPTDGLYLIYSQVLFRGQGCPSTNVFLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKDDRLSAEINLPDYLDFAESGQVYFGIIAL |
| MW | 16.9 kDa |
| Form | Lyophilized |
| Storage | -20°C |
| Shipping Conditions | Room temperature |
Related Products
Rat TNF-alpha/TNFA Recombinant Protein (RPES4243)
system_update_altDatasheetRat TNF-alpha/TNFA Recombinant Protein Tumor necrosis factor alpha (TNF-alpha, TNFSF2) is the prototypic ligand of the TNF superfamily. Rat TNF-alpha consisits of a 35 a
Human TNF-alpha/TNFA Recombinant Protein (RPES1664)
system_update_altDatasheetHuman TNF-alpha/TNFA Recombinant Protein Tumor Necrosis Factor-? (TNF-?) is secreted by macrophages; monocytes; neutrophils; T-cells; and NK-cells following stimulation