Recombinant Porcine CXCL9 Protein (KPRT0113)
- SKU:
- KPRT0113
- Product Type:
- Recombinant Protein
- Species:
- Pig
Description
Recombinant Porcine CXCL9 Protein (KPRT0113)
| Product SKU | KPRT0113 |
| Product Type | Recombinant Protein |
| Quantity | 5 ug |
| Species | Porcine |
| Target | CXCL9 |
| Alias | MIG; CXCL9; CMK; Humig; MIG; SCYB9; crg-10 |
| Source | Yeast |
| No. Amino Acids | 104 |
| Protein Sequence | TLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT (104) |
| MW | 12.1 kDa |
| Form | Lyophilized |
| Storage | -20°C |
| Shipping Conditions | Room temperature |
Related Products
Mouse CXCL9 Recombinant Protein (RPES0301)
Chemokines Recombinant Proteins
system_update_altDatasheetMouse CXCL9 Recombinant Protein Chemokine (C-X-C motif) ligand 9 (CXCL9, MIG), is a small cytokine belonging to the CXC chemokine family. CXCL9 functions as one of the t
Mouse CXCL9 Recombinant Protein (RPES1869)
Immunology Recombinant Proteins
system_update_altDatasheetMouse CXCL9 Recombinant Protein Chemokine (C-X-C Motif) Ligand 9 (CXCL9) belongs to the intercrine alpha (chemokine CXC) family. It is secreted by interferon stimulated
Human CXCL9 Recombinant Protein (RPES1444)
Chemokines Recombinant Proteins
system_update_altDatasheetHuman CXCL9 Recombinant Protein Chemokine (C-X-C Motif) Ligand 9 (CXCL9) belongs to the intercrine alpha (chemokine CXC) family. It is secreted by interferon stimulated