Recombinant Mouse Annexin V Protein (KPRT0577)
- SKU:
- KPRT0577
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
Recombinant Mouse Annexin V Protein (KPRT0577)
| Product SKU | KPRT0577 |
| Product Type | Recombinant Protein |
| Quantity | 5 ug |
| Species | Mouse |
| Target | Annexin |
| Alias | |
| Source | Yeast |
| No. Amino Acids | 319 |
| Protein Sequence | MATRGTVTDFPGFDGRADAEVLRKAMKGLGTDEDSILNLLTSRSNAQRQEIAQEFKTLFGRDLVDDLKSELTGKFEKLIVAMMKPSRLYDAYELKHALKGAGTDEKVLTEIIASRTPEELSAIKQVYEEEYGSNLEDDVVGDTSGYYQRMLVVLLQANRDPDTAIDDAQVELDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRRVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVVVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGGEDD (319) |
| MW | 35.8 kDa |
| Form | Lyophilized |
| Storage | -20°C |
| Shipping Conditions | Room temperature |
Related Products
Mouse Annexin V Recombinant Protein (His tag)
OverviewProduct Name:Mouse Annexin V Recombinant Protein (His tag)Product Code:RPES5783Size:20µgSpecies:MouseEx
Human Annexin V/Annexin A5 Recombinant Protein (RPES3659)
Cardiovascular Recombinant Proteins
system_update_altDatasheetHuman Annexin V/Annexin A5 Recombinant Protein This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex; which
