Recombinant Human Frizzled-1 Protein (KPRT0579)
- SKU:
- KPRT0579
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
Recombinant Human Frizzled-1 Protein (KPRT0579)
| Product SKU | KPRT0579 |
| Product Type | Recombinant Protein |
| Quantity | 5 ug |
| Species | Human |
| Target | Frizzled-1 |
| Alias | |
| Source | Yeast |
| No. Amino Acids | 178 |
| Protein Sequence | QAAGQGPGQGPGPGQQPPPPPQQQQSGQQYNGERGISVPDHGYCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVCTVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGTPTPSLLPEFWTSN (178) |
| MW | 19.4 kDa |
| Form | Lyophilized |
| Storage | -20°C |
| Shipping Conditions | Room temperature |
Related Products
Human Frizzled-6/FZD6 Recombinant Protein (RPES3481)
system_update_altDatasheetHuman Frizzled-6/FZD6 Recombinant Protein This gene represents a member of the 'frizzled' gene family, which encode 7-transmembrane domain proteins that are receptors fo
Human Frizzled-4/FZD4 Recombinant Protein (RPES3054)
system_update_altDatasheetHuman Frizzled-4/FZD4 Recombinant Protein This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are r
Human Frizzled-4/FZD4 Recombinant Protein (RPES3034)
system_update_altDatasheetHuman Frizzled-4/FZD4 Recombinant Protein This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are r
Human Frizzled-7 Recombinant Protein (His tag)
OverviewProduct Name:Human Frizzled-7 Recombinant Protein (His tag)Product Code:RPES5661Size:20µgSpecies:HumanE
Human Frizzled-5/FZD5 Recombinant Protein (RPES2840)
system_update_altDatasheetHuman Frizzled-5/FZD5 Recombinant Protein Wnt signaling is involved in a variety of embryonic development processes of nonvertebrates and vertebrates, where it determine