Rat Tpc1808 Recombinant Protein (RPPB4537)
- SKU:
- RPPB4537
- Product Type:
- Recombinant Protein
- Species:
- Rat
- Uniprot:
- Q9R0C2
Description
| Product Name: | Rat Tpc1808 Recombinant Protein |
| Product Code: | RPPB4537 |
| Size: | 50µg |
| Species: | Rat |
| Target: | Tpc1808 |
| Synonyms: | Tropic 1808, Tpc1808. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The Tropic-1808 was lyophilized from 1X PBS, pH 7.4. |
| Stability: | Lyophilized Tpc1808 although stable 10°C for 1 week, should be stored desiccated below -18°C.Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | MSYYHHHHHHMNLAQIAALNQISNLNAIRVGQVLKVSNAAGSNNTQNTTQPSAGVPTNTASSTTGYTVKSGDTLSAIAAANGVSLANLLSWNNLSLQAIIYPGQKLTIQNANNATVTTPNAPTSTPTVMPSTNGSYTVKSGDTLYGIAAKLGTNVQTLLSLNGLQLSSTIYVGQVLKTTGAVAGAGTATSTPTPVTPTVSKPAAANGVSTAGLSAAQAAWLRTAVVDAQAATAGTGVLASVTVAQAILESGWGQSALASAPYHNFNLYLIKVKNTWKLMTLLLS |
| UniProt Code: | Q9R0C2 |
Tropic 1808 is a candidate chemotropic factor induced by nerve injury. Tpc1808 protein, similar to NGF, could promote the expression of NF-H in a time-dependent manner. Tpc1808 is the gene related to promotion of nerve growth, and both the Tpc1808 gene and the Tpc1808 recombinant protein up-regulate the expression of NF-H in PC12 cells.
Tropic-1808�Rat Recombinant protein fused to N-terminal His-Tag produced in E.Coli is a single, non-glycosylated polypeptide chain containing 285 amino acids and having a molecular mass of 29.1 kDa.The Tpc1808 is purified by proprietary chromatographic techniques.
Related Products
Rat EGF Recombinant Protein
OverviewProduct Name:Rat EGF Recombinant Protein Product Code:RPES6815Size:100µgSpecies:RatExpression Host:
Rat EGF Protein Recombinant Protein (RPPB0180)
Growth Factors & Cytokines Recombinant Proteins
system_update_altDatasheetsystem_update_altMSDS
Rat HepaCAM2 Recombinant Protein (RPES0176)
system_update_altDatasheetRat HepaCAM2 Recombinant Protein HepaCAM2 belongs to the immunoglobulin family. HepaCAM2, together with HEPACAM1, are cell adhesion molecules. HEPACAM1 modulates cell ad
Rat MBL1 Recombinant Protein (RPES5178)
system_update_altDatasheetRat MBL1 Recombinant Protein Mannose-binding lectin (MBL), also named mannose or mannan-binding protein (MBP), is a C-type lectin which participates in the innate immune
Rat TDGF1 Recombinant Protein (RPES5147)
system_update_altDatasheetRat TDGF1 Recombinant Protein Cripto/TDGF1 is a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. EGF-CFC family member proteins shar