Pufferfish Leptin Recombinant Protein (RPPB0714)
- SKU:
- RPPB0714
- Product Type:
- Recombinant Protein
- Species:
- Fish
- Uniprot:
- Q588G0
Description
| Product Name: | Pufferfish Leptin Recombinant Protein |
| Product Code: | RPPB0714 |
| Size: | 100µg |
| Species: | Pufferfish |
| Target: | Leptin |
| Synonyms: | OB Protein, Obesity Protein, OBS, Obesity factor. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3. |
| Solubility: | It is recommended to reconstitute the lyophilized Pufferfish Leptin in sterile 0.4% NaHCO3 pH-9 not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 99.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVEGSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQEQQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC |
| Biological Activity: | Biological active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins. |
| UniProt Code: | Q588G0 |
A 16-kDa peptide hormone secreted from white adipocytes and implicated in the regulation of food intake and energy balance. Leptin provides the key afferent signal from fat cells in the feedback system that controls body fat stores.
Leptin Pufferfish (Takifugu rubripes) Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain having a molecular mass of 16 kDa. Bioactive Leptin Pufferfish (Takifugu rubripes) Recombinant was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al (in press), General and Comparative Endocrinology.The Pufferfish Leptin is purified by proprietary chromatographic techniques.
Related Products
Human Leptin Recombinant Protein (RPPB0716)
Growth Factors & Cytokines Recombinant Proteins
Human Leptin Recombinant Protein (RPPB0703)
Growth Factors & Cytokines Recombinant Proteins
