Hormones Recombinant Proteins

Pramlintide Recombinant Protein (RPPB1352)

(No reviews yet) Write a Review
SKU:
RPPB1352
Product Type:
Recombinant Protein
Research Area:
Hormones

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Pramlintide Recombinant Protein
Product Code:RPPB1352
Size:5mg
Target:Pramlintide
Source:Synthetic
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:The protein was lyophilized with no additives.
Solubility:It is recommended to reconstitute the lyophilized Pramlintide in sterile 18M?-cm H2O not less than 100 �g/ml, which can then be further diluted to other aqueous solutions. The Pramlintide is also soluble in 1% Acetic Acid.
Stability:Lyophilized Pramlintide although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Pramlintide should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 98.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Amino Acid Sequence:KCNTATCATNRLANFLVHSSNNFGPILPPTNVGSNTY-NH2

Pramlintide acetate is a hormone that is released into the bloodstream, in a similar pattern as insulin. Pramlintide aids in the absorption of glucose by slowing gastric emptying, promoting satiety, and inhibiting inappropriate secretion of glucagon, a catabolic hormone that opposes the effects of insulin.

Pramlintide Synthetic is a single, non-glycosylated polypeptide chain containing 37 amino acids, having a molecular mass of 3949.4 Dalton and a Molecular formula of C171H267N51O53S2.

View AllClose

0 Reviews

View AllClose

Related Products