Mouse VEGF165 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6741
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse VEGF165 Recombinant Protein (N-His) (active)
Product Code:RPES6741
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:Dci, Dcip1, Gm1960
Mol Mass:26.11 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is < 3 ng/mL.
Sequence:MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Accession:Q00731-2
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Vascular endothelial growth factor (VEGF); also known as vascular permeability factor (VPF) and VEGF-A; is a potent mediator of both angiogenesis and vasculogenesis in the fetus and adult. It is a member of the platelet-derived growth factor (PDGF)/vascular endothelial growth factor (VEGF) family and often exists as a disulfide-linked homodimer. VEGF-A protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects; including mediating increased vascular permeability; inducing angiogenesis; vasculogenesis and endothelial cell growth; promoting cell migration; inhibiting apoptosis and tumor growth. VEGF-A protein is also a vasodilator that increases microvascular permeability; thus it was originally referred to as vascular permeability factor.
View AllClose

0 Reviews

View AllClose

Related Products