Mouse TRAIL Recombinant Protein (N-His) (active)
- SKU:
- RPES6713
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
| Product Name: | Mouse TRAIL Recombinant Protein (N-His) (active) |
| Product Code: | RPES6713 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | IL36A, Interleukin-1 family member 6 (IL-1F6), FIL1ε (FIL1E), Interleukin-1ε (IL1E), Fi, Fil, Fil1, IL-1, IL-1H1, IL1RP2 |
| Mol Mass: | 34.31 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is < 1 ng/mL. |
| Sequence: | MPSSGALKDLSFSQHFRMMVICIVLLQVLLQAVSVAVTYMYFTNEMKQLQDNYSKIGLACFSKTDEDFWDSTDGEILNRPCLQVKRQLYQLIEEVTLRTFQDTISTVPEKQLSTPPLPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN |
| Accession: | P50592 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis. |
Related Products
Mouse CXCL3 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL3 Recombinant Protein (N-His) (active)Product Code:RPES6731Size:20µgSpecies:Mouse
Mouse CXCL16 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL16 Recombinant Protein (N-His) (active)Product Code:RPES6743Size:20µgSpecies:Mouse
Mouse CXCL5 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL5 Recombinant Protein (N-His) (active)Product Code:RPES6732Size:20µgSpecies:Mouse
Mouse CCL2 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CCL2 Recombinant Protein (N-His) (active)Product Code:RPES6727Size:20µgSpecies:Mouse
Mouse VEGF121 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse VEGF121 Recombinant Protein (N-His) (active)Product Code:RPES6725Size:20µgSpecies:Mouse<