Mouse OX40L Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6711
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse OX40L Recombinant Protein (N-His) (active)
Product Code:RPES6711
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:AGIF (Adipogenesis Inhibitory Factor)
Mol Mass:23.08 kDa
Tag:N-His
Purity:> 95 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to induce IL-2 secretion in mouse T cells in the presence of the anti-CD3 antibody. The ED50 for this effect is < 25 ng/mL.
Sequence:MEGEGVQPLDENLENGSRPRFKWKKTLRLVVSGIKGAGMLLCFIYVCLQLSSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Accession:P43488
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:OX40 ligand (OX40L), also called CD252, is a single-pass type II membrane protein of the TNF/TNF receptor superfamily. OX40L is expressed by DCs, macrophages and B cells and signals via its cognate receptor OX40 which is mainly expressed on APCs. OX40L/OX40 interactions are important in T-cell activation and survival and for the generation of memory T cells from activated effector T cells. OX40L–OX40 co-stimulation leads to activation of TNF receptor associated factor (TRAF) 2, 3 and 5. This pathway has been shown to prolong the survival of effector CD4+Th cells as well as contributes to generation of memory T cells.
View AllClose

0 Reviews

View AllClose

Related Products