Mouse Midkine Recombinant Protein (N-His)
- SKU:
- RPES6736
Description
| Product Name: | Mouse Midkine Recombinant Protein (N-His) |
| Product Code: | RPES6736 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | IP-10, Gamma-Interferon Inducible Protein 10, Crg-2 |
| Mol Mass: | 16.26 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Testing in progress |
| Sequence: | MQHRGFFLLALLALLVVTSAVAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD |
| Accession: | P12025 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Midkine (MK or MDK) also known as neurite growth-promoting factor 2 (NEGF2) is a basic heparin-binding growth factor of low molecular weight, and forms a family with pleiotrophin. Midkine is a retinoic acid-responsive, heparin-binding growth factor expressed in various cell types during embryogenesis. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis. Midkine binds anaplastic lymphoma kinase (ALK) which induces ALK activation and subsequent phosphorylation of the insulin receptor substrate (IRS1), followed by the activation of mitogen-activated protein kinase (MAPK) and PI3-kinase and the induction of cell proliferation. Midkine is involved in neointima formation after arterial injury, possibly by mediating leukocyte recruitment. Also involved in early fetal adrenal gland development. Midkine exhibited increased expression in the breast carcinomas but showed much lower expression in the normal breast tissue. Thus, it can be used as a breast carcinomas marker. |
Related Products
Human Midkine Recombinant Protein (N-His)
OverviewProduct Name:Human Midkine Recombinant Protein (N-His)Product Code:RPES6485Size:20µgSpecies:HumanExpres
Mouse Midkine Recombinant Protein (RPPB0773)
Neurotrophins Recombinant Proteins
system_update_altDatasheetsystem_update_altMSDS
Mouse HDGF Recombinant Protein (N-His)
OverviewProduct Name:Mouse HDGF Recombinant Protein (N-His)Product Code:RPES6724Size:20µgSpecies:MouseExpressio
Mouse GDNF Recombinant Protein (N-His)
OverviewProduct Name:Mouse GDNF Recombinant Protein (N-His)Product Code:RPES6735Size:20µgSpecies:MouseExpressio