Name: Mouse LIGHT Recombinant Protein (N-His) (active)
SKU: RPES6710
Availability: OutOfStock

Mouse LIGHT Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

SKU:

RPES6710

Product Type:

Recombinant Protein

Species:

Mouse

Description

View AllClose

0 Reviews

View AllClose

OverviewProduct Name:Mouse CXCL3 Recombinant Protein (N-His) (active)Product Code:RPES6731Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CXCL16 Recombinant Protein (N-His) (active)Product Code:RPES6743Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CXCL5 Recombinant Protein (N-His) (active)Product Code:RPES6732Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CCL2 Recombinant Protein (N-His) (active)Product Code:RPES6727Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse VEGF121 Recombinant Protein (N-His) (active)Product Code:RPES6725Size:20µgSpecies:Mouse<

Mol Mass:	27.17 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to induce cytotoxicity in HT-29 cells. The ED50 for this effect is < 2 μg/mL.

Sequence:	MESVVQPSVFVVDGQTDIPFRRLEQNHRRRRCGTVQVSLALVLLLGAGLATQGWFLLRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV
Accession:	Q9QYH9
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	Cytokine that binds to TNFRSF3/LTBR. Binding to the decoy receptor TNFRSF6B modulates its effects. Activates NFKB and stimulates the proliferation of T-cells. Acts as a ligand for TNFRSF14/HVEM. Upon binding to TNFRSF14/HVEM, delivers costimulatory signals to T cells, leading to T cell proliferation and IFNG production.