Cytokines Recombinant Proteins

Mouse IL17F Recombinant Protein (RPPB0611)

(No reviews yet) Write a Review
SKU:
RPPB0611

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Mouse IL17F Recombinant Protein
Product Code:RPPB0611
Size:25µg
Species:Mouse
Target:IL17F
Synonyms:Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives.
Solubility:It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions.
Stability:Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Amino Acid Sequence:RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

IL-17F having an accession number of Q96PD4 is a cytokine that shares sequence similarity with IL17. IL-17F is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM-CSF. IL-17F inhibits the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. IL-17F induces stromal cells to produce proinflammatory and hematopoietic cytokines. Intestinal IL17F gene expression is increased in active CD.IL-17A & IL-17F alleles influence the susceptibility to and pathophysiological features of ulcerative colitis independently. IL-17F and MIF gene polymorphisms are significantly associated with the development of functional dyspepsia. The initiation of IL-17F/IL-17R signaling pathway requires the receptor ubiquitination by TRAF6. IL-17F induces expression of IFN-gamma-inducible protein 10 (IP-10) by activating Raf1-mitogen-activated protein kinase 1/2-extracellular-regulated kinase 1/2-p90 ribosomal S6 kinase-cyclic AMP response element-binding protein signaling pathway.

IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.

UniProt Protein Function:IL17F: Stimulates the production of other cytokines such as IL- 6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. Defects in IL17F are the cause of familial candidiasis type 6 (CANDF6). CANDF6 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans. Belongs to the IL-17 family.Protein type: Secreted; Secreted, signal peptide; CytokineCellular Component: extracellular space; extracellular regionMolecular Function: protein homodimerization activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine binding; cytokine activityBiological Process: proteoglycan metabolic process; negative regulation of angiogenesis; regulation of transforming growth factor beta receptor signaling pathway; regulation of interleukin-8 biosynthetic process; regulation of interleukin-2 biosynthetic process; cytokine biosynthetic process; lymphotoxin A biosynthetic process; regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; cartilage development; regulation of interleukin-6 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; inflammatory response
UniProt Protein Details:
NCBI Summary:
UniProt Code:Q7TNI7
NCBI GenInfo Identifier:81894490
NCBI Gene ID:257630
NCBI Accession:Q7TNI7.1
UniProt Secondary Accession:Q7TNI7,Q8K4C3
UniProt Related Accession:Q7TNI7
Molecular Weight:17,020 Da
NCBI Full Name:Interleukin-17F
NCBI Synonym Full Names:interleukin 17F
NCBI Official Symbol:Il17f��
NCBI Official Synonym Symbols:C87042; IL-17F��
NCBI Protein Information:interleukin-17F
UniProt Protein Name:Interleukin-17F
UniProt Synonym Protein Names:
Protein Family:Interleukin
UniProt Gene Name:Il17f��
UniProt Entry Name:IL17F_MOUSE
View AllClose

Additional Information

Product Type:
Recombinant Protein
Species:
Mouse
Uniprot:
Q7TNI7
Research Area:
Cytokines
View AllClose

Related Products