Cytokines Recombinant Proteins
Mouse IL17F Recombinant Protein (RPPB0611)
- SKU:
- RPPB0611
- Product Type:
- Recombinant Protein
- Species:
- Mouse
- Uniprot:
- Q7TNI7
- Research Area:
- Cytokines
Description
| Product Name: | Mouse IL17F Recombinant Protein |
| Product Code: | RPPB0611 |
| Size: | 25µg |
| Species: | Mouse |
| Target: | IL17F |
| Synonyms: | Cytokine ML-1, IL-17F, Interleukin-17F precursor, IL17F, ML1, ML-1. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | IL17F was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Solubility: | It is recommended to reconstitute the lyophilized Mouse IL17F in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized Murine IL17F although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17F should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 97.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | RKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
IL-17F having an accession number of Q96PD4 is a cytokine that shares sequence similarity with IL17. IL-17F is expressed by activated T cells, and has been shown to stimulate the production of several other cytokines, including IL6, IL8, and CSF2/GM-CSF. IL-17F inhibits the angiogenesis of endothelial cells and induce endothelial cells to produce IL2, TGFB1/TGFB, and monocyte chemoattractant protein-1. IL-17F induces stromal cells to produce proinflammatory and hematopoietic cytokines. Intestinal IL17F gene expression is increased in active CD.IL-17A & IL-17F alleles influence the susceptibility to and pathophysiological features of ulcerative colitis independently. IL-17F and MIF gene polymorphisms are significantly associated with the development of functional dyspepsia. The initiation of IL-17F/IL-17R signaling pathway requires the receptor ubiquitination by TRAF6. IL-17F induces expression of IFN-gamma-inducible protein 10 (IP-10) by activating Raf1-mitogen-activated protein kinase 1/2-extracellular-regulated kinase 1/2-p90 ribosomal S6 kinase-cyclic AMP response element-binding protein signaling pathway.
IL17F Mouse Recombinant produced in E.Coli is a homodimeric, non-glycosylated polypeptide chain containing a total of 266 amino acids and having a molecular mass of 29.8 kDa. The Mouse IL-17F is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | IL17F: Stimulates the production of other cytokines such as IL- 6, IL-8 and granulocyte colony-stimulating factor, and can regulate cartilage matrix turnover. Stimulates PBMC and T-cell proliferation. Inhibits angiogenesis. Defects in IL17F are the cause of familial candidiasis type 6 (CANDF6). CANDF6 is a rare disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans. Belongs to the IL-17 family.Protein type: Secreted; Secreted, signal peptide; CytokineCellular Component: extracellular space; extracellular regionMolecular Function: protein homodimerization activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; cytokine binding; cytokine activityBiological Process: proteoglycan metabolic process; negative regulation of angiogenesis; regulation of transforming growth factor beta receptor signaling pathway; regulation of interleukin-8 biosynthetic process; regulation of interleukin-2 biosynthetic process; cytokine biosynthetic process; lymphotoxin A biosynthetic process; regulation of granulocyte macrophage colony-stimulating factor biosynthetic process; cartilage development; regulation of interleukin-6 biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; inflammatory response |
| UniProt Protein Details: | |
| NCBI Summary: | |
| UniProt Code: | Q7TNI7 |
| NCBI GenInfo Identifier: | 81894490 |
| NCBI Gene ID: | 257630 |
| NCBI Accession: | Q7TNI7.1 |
| UniProt Secondary Accession: | Q7TNI7,Q8K4C3 |
| UniProt Related Accession: | Q7TNI7 |
| Molecular Weight: | 17,020 Da |
| NCBI Full Name: | Interleukin-17F |
| NCBI Synonym Full Names: | interleukin 17F |
| NCBI Official Symbol: | Il17f�� |
| NCBI Official Synonym Symbols: | C87042; IL-17F�� |
| NCBI Protein Information: | interleukin-17F |
| UniProt Protein Name: | Interleukin-17F |
| UniProt Synonym Protein Names: | |
| Protein Family: | Interleukin |
| UniProt Gene Name: | Il17f�� |
| UniProt Entry Name: | IL17F_MOUSE |
Related Products
Rat IL17F Recombinant Protein (RPPB0616)
Cytokines Recombinant Proteins
Human IL17F Recombinant Protein (RPPB0604)
Cytokines Recombinant Proteins
Human IL17F Recombinant Protein (RPPB0606)
Cytokines Recombinant Proteins
Mouse EGF Protein Recombinant Protein (RPPB0168)
Growth Factors & Cytokines Recombinant Proteins
