Mouse IL-5 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6684
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse IL-5 Recombinant Protein (N-His) (active)
Product Code:RPES6684
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:Interleukin-5, IL-5, B-cell differentiation factor I, Eosinophil differentiation factor, T-cell replacing factor, TRF, IL5
Mol Mass:16.24 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 106IU/mg.
Sequence:MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Accession:P04401
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.
View AllClose

0 Reviews

View AllClose

Related Products