Mouse IL-5 Recombinant Protein (N-His) (active)
- SKU:
- RPES6684
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
| Product Name: | Mouse IL-5 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6684 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | Interleukin-5, IL-5, B-cell differentiation factor I, Eosinophil differentiation factor, T-cell replacing factor, TRF, IL5 |
| Mol Mass: | 16.24 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 106IU/mg. |
| Sequence: | MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG |
| Accession: | P04401 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells. |
Related Products
Mouse IL-36 alpha Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-36 alpha Recombinant Protein (N-His) (active)Product Code:RPES6703Size:20µgSpecies:Mouse<
Mouse IL-19 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse IL-19 Recombinant Protein (N-His) (active)Product Code:RPES6730Size:20µgSpecies:Mouse
Mouse LIGHT Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse LIGHT Recombinant Protein (N-His) (active)Product Code:RPES6710Size:20µgSpecies:Mouse
Mouse BAFF Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse BAFF Recombinant Protein (N-His) (active)Product Code:RPES6708Size:20µgSpecies:Mouse
Mouse CNTF Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CNTF Recombinant Protein (N-His) (active)Product Code:RPES6734Size:20µgSpecies:Mouse