Mouse IL-5 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

Description

View AllClose

View AllClose

OverviewProduct Name:Mouse IL-21 Recombinant Protein (N-His) (active)Product Code:RPES6692Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-11 Recombinant Protein (N-His) (active)Product Code:RPES6701Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-20 Recombinant Protein (N-His) (active)Product Code:RPES6691Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-25 Recombinant Protein (N-His) (active)Product Code:RPES6694Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-7 Recombinant Protein (N-His) (active)Product Code:RPES6685Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-34 Recombinant Protein (N-His) (active)Product Code:RPES6702Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-28A Recombinant Protein (N-His) (active)Product Code:RPES6696Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-9 Recombinant Protein (N-His) (active)Product Code:RPES6698Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse IL-24 Recombinant Protein (N-His) (active)Product Code:RPES6693Size:20µgSpecies:Mouse

Mol Mass:	16.24 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. The specific activity of recombinant mouse IL-5 is > 5 x 106IU/mg.

Sequence:	MRRMLLHLSVLTLSCVWATAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Accession:	P04401
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	Factor that induces terminal differentiation of late-developing B-cells to immunoglobulin secreting cells.

Product Name:	Mouse IL-5 Recombinant Protein (N-His) (active)
Product Code:	RPES6684
Size:	20µg
Species:	Mouse
Expression Host:	E.coli
Synonyms:	Interleukin-5, IL-5, B-cell differentiation factor I, Eosinophil differentiation factor, T-cell replacing factor, TRF, IL5