Mouse IL-28A Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6696
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse IL-28A Recombinant Protein (N-His) (active)
Product Code:RPES6696
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:GRO-α: MGSAα, NAP-3, GRO1, KC (murine)
Mol Mass:22.57 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to protect HepG2 cells infected with encephalomyocarditis (EMC) virus. The ED50 for this effect is < 2 ng/mL.
Sequence:MLLLLLPLLLAAVLTRTQADPVPRATRLPVEAKDCHIAQFKSLSPKELQAFKKAKDAIEKRLLEKDLRCSSHLFPRAWDLKQLQVQERPKALQAEVALTLKVWENMTDSALATILGQPLHTLSHIHSQLQTCTQLQATAEPRSPSRRLSRWLHRLQEAQSKETPGCLEASVTSNLFRLLTRDLKCVANGDQCV
Accession:Q4VK74
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:IL-28A (Interferon-λ2,IFN-λ2), IL-28B/IFN-λ3, and IL-29/IFN-λ1 are type III interferons which are distantly related to IL-10 family and type I IFN family cytokines. Mature human IL-28A is an approximately 22-25 kDa protein that shares 66% amino acid (aa) sequence identity with mouse and rat IL-28A and shows cross-species activity. It shares 96% and 70% aa sequence identity with human IL-28B and IL-29, respectively. IL-28A promotes the Th1 polarization of dendritic cells in the airway and inhibits Th2 and Th17 mediated inflammation. IL-28A additionally exhibits anti-tumor activity, in part by enhancing IL-12 dependent anti-tumor CTL responses in vivo. In contrast, it is up-regulated in invasive bladder cancer where it promotes tumor cell migration.
View AllClose

0 Reviews

View AllClose

Related Products