Mouse GDNF Recombinant Protein (N-His)
- SKU:
- RPES6735
- Product Type:
- Recombinant Protein
- Species:
- Mouse
Description
| Product Name: | Mouse GDNF Recombinant Protein (N-His) |
| Product Code: | RPES6735 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | VPF |
| Mol Mass: | 24.49 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Testing in progress |
| Sequence: | MKLWDVVAVCLVLLHTASAFPLPAGKRLLEAPAEDHSLGHRRVPFALTSDSNMPEDYPDQFDDVMDFIQATIKRLKRSPDKQAAALPRRERNRQAAAASPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCESAETMYDKILKNLSRSRRLTSDKVGQACCRPVAFDDDLSFLDDNLVYHILRKHSAKRCGCI |
| Accession: | P48540 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Glial Cell Line-Derived Neurotrophic Factor (GDNF) is a disulfide-linked homodimeric glycoprotein that belongs to the TGF-β superfamily. It has been shown to promote the survival of various neuronal subpopulations in both the central as well as the peripheral nervous systems at different stages of their development. Human GDNF cDNA encodes a 211 amino acid residue prepropeptide that is processed to yield a dimeric protein. Mature human GDNF was predicted to contain two 134 amino acid residue subunits. Cells known to express GDNF include Sertoli cells, type 1 astrocytes, Schwann cells, neurons, pinealocytes and skeletal muscle cells. Mutations in this gene may be associated with Hirschsprung disease. |
Related Products
Mouse GDNF Recombinant Protein (RPPB0296)
Neurotrophins Recombinant Proteins
system_update_altDatasheetsystem_update_altMSDS
Mouse Midkine Recombinant Protein (N-His)
OverviewProduct Name:Mouse Midkine Recombinant Protein (N-His)Product Code:RPES6736Size:20µgSpecies:MouseExpres
Mouse CDNF Recombinant Protein (N-His)
OverviewProduct Name:Mouse CDNF Recombinant Protein (N-His)Product Code:RPES6733Size:20µgSpecies:MouseExpressio
Mouse HDGF Recombinant Protein (N-His)
OverviewProduct Name:Mouse HDGF Recombinant Protein (N-His)Product Code:RPES6724Size:20µgSpecies:MouseExpressio
Mouse FasL Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse FasL Recombinant Protein (N-His) (active)Product Code:RPES6709Size:20µgSpecies:Mouse
Mouse CXCL10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6726Size:20µgSpecies:Mouse
Mouse TRAIL Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse TRAIL Recombinant Protein (N-His) (active)Product Code:RPES6713Size:20µgSpecies:Mouse
Mouse CXCL3 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL3 Recombinant Protein (N-His) (active)Product Code:RPES6731Size:20µgSpecies:Mouse
Mouse CXCL16 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL16 Recombinant Protein (N-His) (active)Product Code:RPES6743Size:20µgSpecies:Mouse