Mouse Flt-3 Ligand Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6719
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse Flt-3 Ligand Recombinant Protein (N-His) (active)
Product Code:RPES6719
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:soluble Fas Ligand (sFasL), TNFSF6, CD95L, Apo I Ligand, APTL, APT1LG1, CD178, Fas-Lg, Tnfs, Tnlg1a, gld
Mol Mass:26.97 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED50 for this effect is < 2 ng/mL.
Sequence:MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
Accession:P49772
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:The cluster of differentiation (CD) system is commonly used as cell markers in immunophynotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD135, also known as FLT-3, FLK-2, is a member of the CD system. CD135 is an important cell surface marker recognized by specific sets of antibodies to identify the types of hematopoietic (blood) progenitors in the bone marrow and it function to differentiate hematopoietic stem cells, which are CD135 negative, from multipotent progenitors, which are CD135 positive. CD135 is a receptor tyrosine kinase typeⅢ for the cytokine Flt3 ligand and activat signaling through second messengers by binding to Flt3. Signaling through CD135 is important for lymphocyte development. The encoding gene CD135 is a proto-oncogene to which mutations happened will lead to cancer such as leukemia.
View AllClose

0 Reviews

View AllClose

Related Products