Mouse CXCL7 (40-113) Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review
SKU:
RPES6738
Product Type:
Recombinant Protein
Species:
Mouse

Description

Product Name:Mouse CXCL7 (40-113) Recombinant Protein (N-His) (active)
Product Code:RPES6738
Size:20µg
Species:Mouse
Expression Host:E.coli
Synonyms:MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2
Mol Mass:13.08 kDa
Tag:N-His
Purity:> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 1 μg/mL.
Sequence:MGFRLRPTSSCTRACPLHNLQILLLLGLILVALAPLTAGKSDGMDPYIELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKILEGY
Accession:Q9EQI5
Storage:Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:Please refer to the printed manual for detailed information.
Background:Human Chemokine (C-X-C motif) Ligand 7 (CXCL7); also known as neutrophil activating peptide 2 (NAP-2); is a member of the CXC chemokines containing an ELR domain (Glu-Leu-Arg tripeptide motif). Similar to other ELR domain containing CXC chemokines; such as IL-8 and the GRO proteins; CXCL7 binds CXCR2; chemoattracts and activates neutrophils. CXCL7; Connective Tissue Activating Protein III (CTAPIII) and βthrombogulin (βTG); are proteolytically processed carboxylterminal fragments of platelet basic protein (PBP) which is found in the alphagranules of human platelets. Although CTAPIII; βTG; and PBP represent amino-terminal extended variants of NAP2 and possess the same CXC chemokine domains; these proteins do not exhibit CXCL7/NAP2 activity. CXCL7 induces cell migration through the G-protein-linked receptor CXCR-2.
View AllClose

0 Reviews

View AllClose

Related Products