Mouse CXCL3 Recombinant Protein (N-His) (active)

(No reviews yet) Write a Review

Description

View AllClose

View AllClose

OverviewProduct Name:Mouse CXCL16 Recombinant Protein (N-His) (active)Product Code:RPES6743Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CXCL5 Recombinant Protein (N-His) (active)Product Code:RPES6732Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CCL2 Recombinant Protein (N-His) (active)Product Code:RPES6727Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse VEGF121 Recombinant Protein (N-His) (active)Product Code:RPES6725Size:20µgSpecies:Mouse<

OverviewProduct Name:Mouse OX40L Recombinant Protein (N-His) (active)Product Code:RPES6711Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse RANKL Recombinant Protein (N-His) (active)Product Code:RPES6712Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CCL4 Recombinant Protein (N-His) (active)Product Code:RPES6728Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse FasL Recombinant Protein (N-His) (active)Product Code:RPES6709Size:20µgSpecies:Mouse

OverviewProduct Name:Mouse CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6726Size:20µgSpecies:Mouse

Mol Mass:	11.51 kDa
Tag:	N-His
Purity:	> 98 % as determined by reducing SDS-PAGE.
Endotoxin Level:	< 0.1 EU per μg of the protein as determined by the LAL method.
Bio Activity:	Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 80 ng/mL.

Sequence:	MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Accession:	Q6W5C0
Storage:	Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Shipping:	This product is provided as lyophilized powder which is shipped with ice packs.
Formulation:	Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual.
Reconstitution:	Please refer to the printed manual for detailed information.
Background:	C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion.

Product Name:	Mouse CXCL3 Recombinant Protein (N-His) (active)
Product Code:	RPES6731
Size:	20µg
Species:	Mouse
Expression Host:	E.coli
Synonyms:	CSF-1, MGI-IM