Mouse CXCL3 Recombinant Protein (N-His) (active)
- SKU:
- RPES6731
Description
| Product Name: | Mouse CXCL3 Recombinant Protein (N-His) (active) |
| Product Code: | RPES6731 |
| Size: | 20µg |
| Species: | Mouse |
| Expression Host: | E.coli |
| Synonyms: | CSF-1, MGI-IM |
| Mol Mass: | 11.51 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 80 ng/mL. |
| Sequence: | MAPPTCRLLSAALVLLLLLATNHQATGAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS |
| Accession: | Q6W5C0 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | C-X-C Motif Chemokine 3 (CXCL3) is a secreted protein that belongs to the intercrine alpha (chemokine CXC) family. CXCL3 controls the migration and adhesion of monocytes and mediates its effect on its target cell by interacting with a cell surface chemokine receptor called CXCR2. In addition, CXCL3 is thought to play a role in inflammation and exert its effects on endothelial cells in an autocrine fashion. |
Related Products
Mouse FasL Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse FasL Recombinant Protein (N-His) (active)Product Code:RPES6709Size:20µgSpecies:Mouse
Mouse CXCL10 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse CXCL10 Recombinant Protein (N-His) (active)Product Code:RPES6726Size:20µgSpecies:Mouse
Mouse TRAIL Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse TRAIL Recombinant Protein (N-His) (active)Product Code:RPES6713Size:20µgSpecies:Mouse
Mouse VEGF165 Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse VEGF165 Recombinant Protein (N-His) (active)Product Code:RPES6741Size:20µgSpecies:Mouse<
Mouse Neurturin Recombinant Protein (N-His) (active)
OverviewProduct Name:Mouse Neurturin Recombinant Protein (N-His) (active)Product Code:RPES6737Size:20µgSpecies:Mouse