Description
Product Name: | Mouse CXCL1 Recombinant Protein (N-His) (active) |
Product Code: | RPES6686 |
Size: | 20µg |
Species: | Mouse |
Expression Host: | E.coli |
Synonyms: | Growth-Regulated Alpha Protein, C-X-C Motif Chemokine 1, GRO-Alpha(1-73), Melanoma Growth Stimulatory Activity, MGSA, Neutrophil-Activating Protein 3, NAP-3, CXCL1, GRO, GRO1, GROA, MGSA, SCYB1 |
Mol Mass: | 11.08 kDa |
Tag: | N-His |
Purity: | > 95 % as determined by reducing SDS-PAGE. |
Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
Bio Activity: | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED50 for this effect is < 15 ng/mL. |
Sequence: | MIPATRSLLCAALLLLATSRLATGAPIANELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK |
Accession: | P12850 |
Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
Formulation: | Lyophilized from a solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manu |
Reconstitution: | Please refer to the printed manual for detailed information. |
Background: | Growth-regulated alpha protein (CXCL1,KC), is a member of the alpha chemokine subfamily, was initially identified as an immediate early gene induced in mouse fibroblasts by platelet-derived growth factor. The N-terminal processed form KC(5-72) of the protein is produced by proteolytic cleavage after secretion from bone marrow stromal cells, and shows a highly enhanced hematopoietic activity. Mouse KC shows approximately 63% identity to that of mouse MIP-2. KC is also approximately 60% identical to the human GROs. It has been suggested that mouse KC and MIP-2 are the orthologs of the human GROs and rat CINCs. Cxcl1 has chemotactic activity for neutrophils, and contributes to neutrophil activation during inflammation. Hematoregulatory chemokine, in vitro, suppresses hematopoietic progenitor cell proliferation. |