Description
| Product Name: | Human UBE2L3 His Recombinant Protein |
| Product Code: | RPPB2384 |
| Size: | 50µg |
| Species: | Human |
| Target: | UBE2L3 His |
| Synonyms: | Ubiquitin-conjugating enzyme E2 L3, EC 6.3.2.19, Ubiquitin-protein ligase L3,Ubiquitin carrier protein L3, UbcH7, E2-F1, L-UBC, UbcM4. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered white lyophilized powder. |
| Formulation: | Lyophilized from a 0.2?m filtered concentrated (1 mg/ml) solution in 1X PBS and 1mM DTT, pH 7.5. |
| Solubility: | It is recommended to reconstitute the lyophilized UBE2L3 in sterile water not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized UBE2L3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution UBE2L3 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by: (a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | MHHHHHHAMAASRRLMKELEEIRKCGMKNFRNIQVDEANLLTWQGLIVPDNPPYDKGAFRIEINFPAEYPFKPPKITFKTKIYHPNIDEKGQVCLPVISAENWKPATKTDQVIQSLIALVNDPQPEHPLRADLAEEYSKDRKKFCKNAEEFTKKYGEKRPVD |
Human Ubquitin Conjugating Enzyme 7 (UbcH7) is a class I enzyme which functions in the stress response and the control of transcription factors. The enzyme is ubiquitously expressed with high levels of expression seen in adult muscle. UbcH7 mediates the selective degradation of short-lived and abnormal proteins and is highly homologous to UbcH5. It has been demonstrated to participate in the ubiquitinylation of p53, c-Fos and NF-kB. UbcH7 is one of two E2s (UbcH5 being the other) with which HECT domain proteins interact with UbcH7 being able to efficiently substitute for UbcH5 in E6-AP-dependent ubiquitinylation.
Ubiquitin-Conjugating Enzyme E2L 3 Human Recombinant produced in E.coli is an 18.9 kDa protein containing 162 amino acids.The UBE2L3 protein contains 6xHis tag and is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | UBE2L3: Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PARK2 and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-lived and abnormal proteins. Down- regulated during the S-phase it is involved in progression through the cell cycle. Regulates nuclear hormone receptors transcriptional activity. May play a role in myelopoiesis. Interacts with PARK2; involved in ubiquitination and degradation of misfolded proteins. Interacts with UBE3A; used by the papilloma virus HPV-16 E6 protein to ubiquitinate p53/TP53. Interacts with CCNB1IP1, CBL, ZAP70, RNF19A, RNF19B and RNF144B. Interacts with ARIH1. Interacts with ARIH2 (via RING-type 1). Interacts with NCOA1; they functionally interact to regulate progesterone receptor transcriptional activity. May interact with NR3C1. Ubiquitous, with highest expression in testis. Belongs to the ubiquitin-conjugating enzyme family. |
| UniProt Protein Details: | Protein type:Nuclear receptor co-regulator; Ubiquitin conjugating system; EC 6.3.2.19; Ubiquitin ligase; Ligase Chromosomal Location of Human Ortholog: 22q11.21 Cellular Component: cytoplasm; nucleus; ubiquitin ligase complex Molecular Function:protein binding; enzyme binding; ubiquitin protein ligase binding; transcription coactivator activity; ubiquitin-protein ligase activity; ATP binding; ligase activity Biological Process: ubiquitin-dependent protein catabolic process; cell proliferation; protein polyubiquitination; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of protein ubiquitination; positive regulation of ubiquitin-protein ligase activity; protein modification process; protein ubiquitination |
| NCBI Summary: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes (E1s), ubiquitin-conjugating enzymes (E2s) and ubiquitin-protein ligases (E3s). This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is demonstrated to participate in the ubiquitination of p53, c-Fos, and the NF-kB precursor p105 in vitro. Several alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2009] |
| UniProt Code: | P68036 |
| NCBI GenInfo Identifier: | 54039805 |
| NCBI Gene ID: | 7332 |
| NCBI Accession: | P68036.1 |
| UniProt Related Accession: | P68036 |
| Molecular Weight: | |
| NCBI Full Name: | Ubiquitin-conjugating enzyme E2 L3 |
| NCBI Synonym Full Names: | ubiquitin conjugating enzyme E2 L3 |
| NCBI Official Symbol: | UBE2L3�� |
| NCBI Official Synonym Symbols: | E2-F1; L-UBC; UBCH7; UbcM4�� |
| NCBI Protein Information: | ubiquitin-conjugating enzyme E2 L3 |
| UniProt Protein Name: | Ubiquitin-conjugating enzyme E2 L3 |
| UniProt Synonym Protein Names: | L-UBC; UbcH7; Ubiquitin carrier protein L3; Ubiquitin-conjugating enzyme E2-F1; Ubiquitin-protein ligase L3 |
| UniProt Gene Name: | UBE2L3�� |
| UniProt Entry Name: | UB2L3_HUMAN |
Additional Information
Product Type: |
Recombinant Protein |
Species: |
Human |
Uniprot: |
P68036 |
Research Area: |
Enzymes |