Human TWEAK Recombinant Protein (N-His) (active)
- SKU:
- RPES6436
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human TWEAK Recombinant Protein (N-His) (active) |
| Product Code: | RPES6436 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | TNFSF12, DR3LG, Apo3 Ligand |
| Mol Mass: | 28.04 kDa |
| Tag: | N-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce proliferation in HUVEC cells. The ED50 for this effect is < 6 ng/mL. |
| Sequence: | MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
| Accession: | O43508 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is a ligand for the FN14/TWEAKR receptor. TNFSF12 has overlapping signaling functions with TNF, but displays a much wider tissue distribution. It can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. It is also found that TNFSF12 promotes proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. TNFSF12 also is a weak inducer of apoptosis in some cell types and mediates NF-kappa-B activation. |
Related Products
Human LIGHT, Human Recombinant Protein (N-His) (active)
OverviewProduct Name:Human LIGHT, Human Recombinant Protein (N-His) (active)Product Code:RPES6433Size:20µgSpecies:Human
Human CD27L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD27L Recombinant Protein (N-His) (active)Product Code:RPES6430Size:20µgSpecies:Human
Human FasL Recombinant Protein (N-His) (active)
OverviewProduct Name:Human FasL Recombinant Protein (N-His) (active)Product Code:RPES6432Size:20µgSpecies:Human
Human CXCL11 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL11 Recombinant Protein (N-His) (active)Product Code:RPES6504Size:20µgSpecies:Human
Human CXCL9 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL9 Recombinant Protein (N-His) (active)Product Code:RPES6503Size:20µgSpecies:Human
Human CXCL4 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CXCL4 Recombinant Protein (N-His) (active)Product Code:RPES6501Size:20µgSpecies:Human
Human CD326 Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD326 Recombinant Protein (N-His) (active)Product Code:RPES6488Size:20µgSpecies:Human
Human CD30L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD30L Recombinant Protein (N-His) (active)Product Code:RPES6431Size:20µgSpecies:Human
Human CNTF Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CNTF Recombinant Protein (N-His) (active)Product Code:RPES6484Size:20µgSpecies:Human