Human TL1A Recombinant Protein (C-His) (active)
- SKU:
- RPES6435
- Product Type:
- Recombinant Protein
- Species:
- Human
Description
| Product Name: | Human TL1A Recombinant Protein (C-His) (active) |
| Product Code: | RPES6435 |
| Size: | 20µg |
| Species: | Human |
| Expression Host: | E.coli |
| Synonyms: | TNFSF15, VEGI |
| Mol Mass: | 22 kDa |
| Tag: | C-His |
| Purity: | > 98 % as determined by reducing SDS-PAGE. |
| Endotoxin Level: | < 0.1 EU per μg of the protein as determined by the LAL method. |
| Bio Activity: | Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.2 ng/mL. |
| Sequence: | QLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL |
| Accession: | O95150 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 8.0 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | TL-1A belongs to the TNF superfamily of ligands. It is specially expressed in endothelial cells, and is detected in the placenta, lung, kidney skeletal muscle, pancreas, small intestine and colon. TL-1A inhibits endothelial cell proliferation and angiogenesis. It has been proved to promote NF-KB activation, caspase activity, and apoptosis in responding cell lines. TL-1Acan bind with TNFRSF25/DR3 receptor and a decoy receptor TNFRSF21/DR6. |
Related Products
Human TL1A Recombinant Protein (RPES3142)
system_update_altDatasheetHuman TL1A Recombinant Protein TL1A, also known as TNFSF15, is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is specifically expressed in
Human Noggin Recombinant Protein (C-His) (active)
OverviewProduct Name:Human Noggin Recombinant Protein (C-His) (active)Product Code:RPES6507Size:20µgSpecies:Human
Human IL-34 Recombinant Protein (C-His) (active)
OverviewProduct Name:Human IL-34 Recombinant Protein (C-His) (active)Product Code:RPES6426Size:20µgSpecies:Human
Human CD27L Recombinant Protein (N-His) (active)
OverviewProduct Name:Human CD27L Recombinant Protein (N-His) (active)Product Code:RPES6430Size:20µgSpecies:Human
Human TWEAK Recombinant Protein (N-His) (active)
OverviewProduct Name:Human TWEAK Recombinant Protein (N-His) (active)Product Code:RPES6436Size:20µgSpecies:Human