Description
| Product Name: | Human SELE Recombinant Protein |
| Product Code: | RPPB4613 |
| Size: | 10µg |
| Species: | Human |
| Target: | SELE |
| Synonyms: | E-selectin, Endothelial leukocyte adhesion molecule 1, ELAM-1, Leukocyte-endothelial cell adhesion molecule 2, LECAM2, CD62E antigen, SELE, ELAM1, ELAM, ESEL, CD62E. |
| Source: | HEK293 Cells |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | SELE was lyophilized from a 0.2 �M filtered solution of PBS and 4% Mannitol, pH 7.5. |
| Solubility: | It is recommended to reconstitute the lyophilized SELE in 1xPBS to a concentration no less than 100 �g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95% as determined by SDS-PAGE. |
| Amino Acid Sequence: | WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPVDHHHHHH |
E-selectin which is also called Endothelial leukocyte adhesion molecule 1, ELAM1, ELAM belongs to a family of divalent cation-dependent carbohydrate-binding glycoproteins or adhesion molecules. Eselectin is expressed on the surface of endothelial cells and mediates the interaction of leukocytes and platelets with endothelial cells during an inflammatory response. E-selectin is present in single copy in the human genome and contains 14 exons spanning about 13 kb of DNA.
SELE Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 543 amino acids (22-556). SELE is fused to an 8 amino acid His-tag at C-terminus�is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | SELE: Cell-surface glycoprotein having a role in immunoadhesion. Mediates in the adhesion of blood neutrophils in cytokine-activated endothelium through interaction with PSGL1/SELPLG. May have a role in capillary morphogenesis. Belongs to the selectin/LECAM family. |
| UniProt Protein Details: | Protein type:Membrane protein, integral Chromosomal Location of Human Ortholog: 1q22-q25 Cellular Component: cortical cytoskeleton; extracellular space; perinuclear region of cytoplasm; plasma membrane; integral to membrane; coated pit; caveola; lipid raft Molecular Function:protein binding; transmembrane receptor activity; phospholipase binding; sialic acid binding Biological Process: positive regulation of leukocyte migration; positive regulation of receptor internalization; actin filament-based process; calcium-mediated signaling; response to lipopolysaccharide; leukocyte migration during inflammatory response; heterophilic cell adhesion; leukocyte adhesion; phospholipase C activation; regulation of inflammatory response; blood coagulation; inflammatory response; leukocyte tethering or rolling; leukocyte migration Disease: Hypertension, Essential |
| NCBI Summary: | The protein encoded by this gene is found in cytokine-stimulated endothelial cells and is thought to be responsible for the accumulation of blood leukocytes at sites of inflammation by mediating the adhesion of cells to the vascular lining. It exhibits structural features such as the presence of lectin- and EGF-like domains followed by short consensus repeat (SCR) domains that contain 6 conserved cysteine residues. These proteins are part of the selectin family of cell adhesion molecules. Adhesion molecules participate in the interaction between leukocytes and the endothelium and appear to be involved in the pathogenesis of atherosclerosis. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P16581 |
| NCBI GenInfo Identifier: | 126180 |
| NCBI Gene ID: | 6401 |
| NCBI Accession: | P16581.1 |
| UniProt Secondary Accession: | P16581,P16111, A2RRD6, |
| UniProt Related Accession: | P16581 |
| Molecular Weight: | 66,655 Da |
| NCBI Full Name: | E-selectin |
| NCBI Synonym Full Names: | selectin E |
| NCBI Official Symbol: | SELE�� |
| NCBI Official Synonym Symbols: | ELAM; ESEL; CD62E; ELAM1; LECAM2�� |
| NCBI Protein Information: | E-selectin; ELAM-1; endothelial adhesion molecule 1; CD62 antigen-like family member E; endothelial leukocyte adhesion molecule 1; leukocyte endothelial cell adhesion molecule 2; leukocyte-endothelial cell adhesion molecule 2 |
| UniProt Protein Name: | E-selectin |
| UniProt Synonym Protein Names: | CD62 antigen-like family member E; Endothelial leukocyte adhesion molecule 1; ELAM-1; Leukocyte-endothelial cell adhesion molecule 2; LECAM2; CD_antigen: CD62E |
| Protein Family: | E-selectin |
| UniProt Gene Name: | SELE�� |
| UniProt Entry Name: | LYAM2_HUMAN |