Human MOG Recombinant Protein (RPPB3989)
- SKU:
- RPPB3989
- Product Type:
- Recombinant Protein
- Species:
- Human
- Uniprot:
- Q16653
Description
| Product Name: | Human MOG Recombinant Protein |
| Product Code: | RPPB3989 |
| Size: | 50µg |
| Species: | Human |
| Target: | MOG |
| Synonyms: | Myelin Oligodendrocyte Glycoprotein, MOG, MOGIG-2, MGC26137. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | The Myelin Oligodendrocyte Glycoprotein was lyophilized from a 0.2�m filtered solution in 20mM HAc-NaAc and 150mM NaCl pH-4.5 |
| Solubility: | It is recommended to reconstitute the lyophilized MOG in sterile 50mM Acetic acid not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 95.0% as determined by SDS-PAGE. |
| Amino Acid Sequence: | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPGHHHHHH |
Myelin Oligodendrocyte Glycoprotein is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a prime target antigen that plays a role in immune-mediated demyelination. Myelin Oligodendrocyte Glycoprotein is involved in completion and maintenance of the myelin sheath and in cell-cell communication. MOG protein was found to differentially expressed in the dorsolateral prefrontal cortex and in the temporal lobe from patients with schizophrenia. MOG-specific antibody is crucial to the initiation of MOG-induced murine experimental autoimmune encephalomyelitis.
Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa.
| UniProt Protein Function: | MOG: Mediates homophilic cell-cell adhesion. Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell- cell communication. Defects in MOG are the cause of narcolepsy type 7 (NRCLP7). Neurological disabling sleep disorder, characterized by excessive daytime sleepiness, sleep fragmentation, symptoms of abnormal rapid-eye-movement (REM) sleep, cataplexy, hypnagogic hallucinations, and sleep paralysis. Cataplexy is a sudden loss of muscle tone triggered by emotions, which is the most valuable clinical feature used to diagnose narcolepsy. Human narcolepsy is primarily a sporadically occurring disorder but familial clustering has been observed. Belongs to the immunoglobulin superfamily. BTN/MOG family. 10 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Membrane protein, integral; Membrane protein, multi-pass Chromosomal Location of Human Ortholog: 6p22.1 Cellular Component: integral to membrane; plasma membrane Biological Process: central nervous system development; positive regulation of MyD88-dependent toll-like receptor signaling pathway; cell adhesion Disease: Narcolepsy 7 |
| NCBI Summary: | The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
| UniProt Code: | Q16653 |
| NCBI GenInfo Identifier: | 317373391 |
| NCBI Gene ID: | 4340 |
| NCBI Accession: | Q16653.2 |
| UniProt Secondary Accession: | Q16653,O00713, O00714, O00715, Q13054, Q13055, A6NDR4 A6NNJ9, A8MY31, B0UZR9, E9PGF0, F8W9D5, |
| UniProt Related Accession: | Q16653 |
| Molecular Weight: | 247 |
| NCBI Full Name: | Myelin-oligodendrocyte glycoprotein |
| NCBI Synonym Full Names: | myelin oligodendrocyte glycoprotein |
| NCBI Official Symbol: | MOG�� |
| NCBI Official Synonym Symbols: | BTN6; BTNL11; MOGIG2; NRCLP7�� |
| NCBI Protein Information: | myelin-oligodendrocyte glycoprotein; MOG Ig-AluB; MOG alpha-5 |
| UniProt Protein Name: | Myelin-oligodendrocyte glycoprotein |
| Protein Family: | Molybdopterin adenylyltransferase |
| UniProt Gene Name: | MOG�� |
| UniProt Entry Name: | MOG_HUMAN |
Related Products
Human MOG Recombinant Protein (RPES4946)
Cell Biology Recombinant Proteins
Human MOG Recombinant Protein (RPES4421)
Human MOG Recombinant Protein (RPES4926)
Cell Biology Recombinant Proteins
Mouse MOG Recombinant Protein (RPES3039)
Cell Biology Recombinant Proteins