Description
| Product Name: | Human MIG Recombinant Protein |
| Product Code: | RPPB1208 |
| Size: | 20µg |
| Species: | Human |
| Target: | MIG |
| Synonyms: | Small inducible cytokine B9, CXCL9, Gamma INF-induced monokine, MIG, chemokine (C-X-C motif) ligand 9, CMK, Humig, SCYB9, crg-10, monokine induced by gamma-INF. |
| Source: | Escherichia Coli |
| Physical Appearance: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation: | Lyophilized from a 0.2?m filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 7.4, 50mM NaCl. |
| Solubility: | It is recommended to reconstitute the lyophilized MIG in sterile 18M?-cm H2O not less than 100�g/ml, which can then be further diluted to other aqueous solutions. |
| Stability: | Lyophilized MIG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL9 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Amino Acid Sequence: | TPVVRKGRCSCISTNQGTIHLQSLKDLKQFAPSPSCEKIEIIATLKNGVQTCLNPDSADVKELIKKWEKQVSQKKKQKNGKKHQKKKVLKVRKSQRSRQKKTT |
| Biological Activity: | Determined by its ability to chemoattract human peripheral blood T-Lymphocytes using a concentration range of 10-100ng/ml corresponding to a Specific Activity of 10,000-100,000IU/mg. |
Chemokine (C-X-C motif) ligand 9 (CXCL9) is a small cytokine belonging to the CXC chemokine family that is also known as Monokine induced by gamma INF (MIG). k It is closely related to two other CXC chemokines called CXCL10 and CXCL11, whose genes are located near the gene for CXCL9 on human chromosome 4. CXCL9, CXCL10 and CXCL11 all elicit their chemotactic functions by interacting with the chemokine receptor CXCR3.
MIG (monokine induced by gamma-INF) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 103 amino acids and having a molecular mass of 11700 Dalton. The MIG is purified by proprietary chromatographic techniques.
| UniProt Protein Function: | CXCL9: Cytokine that affects the growth, movement, or activation state of cells that participate in immune and inflammatory response. Chemotactic for activated T-cells. Binds to CXCR3. Belongs to the intercrine alpha (chemokine CxC) family. |
| UniProt Protein Details: | Protein type:Secreted; Secreted, signal peptide; Motility/polarity/chemotaxis Chromosomal Location of Human Ortholog: 4q21 Cellular Component: extracellular space; extracellular region; external side of plasma membrane Molecular Function:protein binding; CXCR3 chemokine receptor binding; chemokine activity; cytokine activity Biological Process: positive regulation of leukocyte chemotaxis; response to lipopolysaccharide; defense response; positive regulation of cAMP metabolic process; signal transduction; chemotaxis; positive regulation of myoblast differentiation; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; cell-cell signaling; cellular defense response; immune response; positive regulation of release of sequestered calcium ion into cytosol; inflammatory response; defense response to virus |
| NCBI Summary: | This antimicrobial gene encodes a protein thought to be involved in T cell trafficking. The encoded protein binds to C-X-C motif chemokine 3 and is a chemoattractant for lymphocytes but not for neutrophils. [provided by RefSeq, Sep 2014] |
| UniProt Code: | Q07325 |
| NCBI GenInfo Identifier: | 585487 |
| NCBI Gene ID: | 4283 |
| NCBI Accession: | Q07325.1 |
| UniProt Secondary Accession: | Q07325,Q503B4, |
| UniProt Related Accession: | Q07325 |
| Molecular Weight: | Approximately 150 kDa |
| NCBI Full Name: | C-X-C motif chemokine 9 |
| NCBI Synonym Full Names: | chemokine (C-X-C motif) ligand 9 |
| NCBI Official Symbol: | CXCL9�� |
| NCBI Official Synonym Symbols: | CMK; MIG; Humig; SCYB9; crg-10�� |
| NCBI Protein Information: | C-X-C motif chemokine 9; small-inducible cytokine B9; gamma-interferon-induced monokine; monokine induced by gamma interferon; monokine induced by interferon-gamma |
| UniProt Protein Name: | C-X-C motif chemokine 9 |
| UniProt Synonym Protein Names: | Gamma-interferon-induced monokine; Monokine induced by interferon-gamma; HuMIG; MIG; Small-inducible cytokine B9 |
| Protein Family: | Migration and invasion enhancer |
| UniProt Gene Name: | CXCL9�� |
| UniProt Entry Name: | CXCL9_HUMAN |
Additional Information
Product Type: |
Recombinant Protein |
Species: |
Human |
Uniprot: |
Q07325 |
Research Area: |
Chemokines |