Growth Factors & Cytokines Recombinant Proteins

Human MIF Recombinant Protein (RPPB0760)

(No reviews yet) Write a Review
SKU:
RPPB0760

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Human MIF Recombinant Protein
Product Code:RPPB0760
Size:25µg
Species:Human
Target:MIF
Synonyms:Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:MIF-Protein was lyophilized from 10mM sodium phosphate buffer pH-7.5.
Solubility:It is recommended to reconstitute the lyophilized MIF-Protein in sterile 18M?-cm H2O at a concentration between 0.1mg-1mg per 1ml.
Stability:Lyophilized MIF-protein although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MIF-protein should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 97.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Amino Acid Sequence:MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Biological Activity:Human PBMCs were cultured with 0 to 1000ng/ml Human MIF. Production of IL-8 was measured via ELISA after 24 hours. The ED50 which was found to be 88-132ng/ml.

The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

MIF human Recombinant was cloned into an E.coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques.Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain containing 115 amino acids and having a molecular mass of 12.5 kDa.

UniProt Protein Function:MIF: a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. Also acts as a phenylpyruvate tautomerase.
UniProt Protein Details:

Protein type:EC 5.3.2.1; Isomerase; EC 5.3.3.12; Amino Acid Metabolism - tyrosine; Cell development/differentiation; Cytokine; Apoptosis; Amino Acid Metabolism - phenylalanine

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: cell surface; cytoplasm; extracellular region; extracellular space; myelin sheath; nucleoplasm; vesicle

Molecular Function:chemoattractant activity; cytokine activity; dopachrome isomerase activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; phenylpyruvate tautomerase activity; protein binding; receptor binding

Biological Process: blood coagulation; carboxylic acid metabolic process; cell aging; cell proliferation; cell surface receptor linked signal transduction; DNA damage response, signal transduction by p53 class mediator; inflammatory response; innate immune response; leukocyte migration; negative regulation of apoptosis; negative regulation of cellular protein metabolic process; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of myeloid cell apoptosis; positive chemotaxis; positive regulation of B cell proliferation; positive regulation of cytokine secretion; positive regulation of fibroblast proliferation; positive regulation of lipopolysaccharide-mediated signaling pathway; positive regulation of MAP kinase activity; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphorylation; prostaglandin biosynthetic process; regulation of macrophage activation

Disease: Rheumatoid Arthritis, Systemic Juvenile

NCBI Summary:This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
UniProt Code:P14174
NCBI GenInfo Identifier:1170955
NCBI Gene ID:4282
NCBI Accession:P14174.4
UniProt Secondary Accession:P14174,Q2V4Y5, Q6FHV0, A5Z1R8, B2R4S3,
UniProt Related Accession:P14174
Molecular Weight:12,476 Da
NCBI Full Name:Macrophage migration inhibitory factor
NCBI Synonym Full Names:macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol:MIF��
NCBI Official Synonym Symbols:GIF; GLIF; MMIF��
NCBI Protein Information:macrophage migration inhibitory factor
UniProt Protein Name:Macrophage migration inhibitory factor
UniProt Synonym Protein Names:Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12); Phenylpyruvate tautomerase
Protein Family:MIF-like protein
UniProt Gene Name:MIF��
UniProt Entry Name:MIF_HUMAN
View AllClose

Additional Information

Product Type:
Recombinant Protein
Species:
Human
Uniprot:
P14174
Research Area:
Growth Factors & Cytokines
View AllClose

Related Products