Growth Factors & Cytokines Recombinant Proteins

Human MIF His N Recombinant Protein (RPPB0761)

(No reviews yet) Write a Review
SKU:
RPPB0761
Product Type:
Recombinant Protein
Species:
Human
Uniprot:
P14174
Research Area:
Growth Factors & Cytokines

Description

system_update_altDatasheetsystem_update_altMSDS
Product Name:Human MIF His N Recombinant Protein
Product Code:RPPB0761
Size:25µg
Species:Human
Target:MIF His N
Synonyms:Phenylpyruvate tautomerase, Glycosylation-inhibiting factor, GIF, MMIF, MIF.
Source:Escherichia Coli
Physical Appearance:Sterile filtered colorless solution.
Formulation:1mg/ml solution containing PBS pH-7.4.
Stability:Liquid MIF although stable 4°C for 1 week, should be stored below -18°C. Please prevent freeze-thaw cycles.
Purity:Greater than 95.0% as determined by:(a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Amino Acid Sequence:MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSMPMFIVNTNV PRASVPDGFL SELTQQLAQA TGKPPQYIAV HVVPDQLMAF GGSSEPCALC LHSIGKIGGA QNRSYSKLLC GLLAERLRIS PDRVYINYYD MNAANVGWNN STFA

The cytokine Macrophage migration inhibitory factor (MIF) has been identified to be secreted by the pituitary gland and the monocyte/macrophage and to play an important role in endotoxic shock. MIF has the unique property of being released from macrophages and T cells in response to physiological concentrations of glucocorticoids. The secretion of MIF is tightly regulated and decreases at high, anti-inflammatory steroid concentration.

MIF human Recombinant, fused to His-tag at N-terminus, was cloned into an E. coli expression vector and was purified to apparent homogeneity by using conventional column chromatography techniques. Macrophage Inducing Factor Human Recombinant is a single, non-glycosylated, polypeptide chain having amino acids from 1-114 and having a molecular mass of 16.6 kDa.

UniProt Protein Function:MIF: a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. Also acts as a phenylpyruvate tautomerase.
UniProt Protein Details:

Protein type:EC 5.3.2.1; Isomerase; EC 5.3.3.12; Amino Acid Metabolism - tyrosine; Cell development/differentiation; Cytokine; Apoptosis; Amino Acid Metabolism - phenylalanine

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: cell surface; cytoplasm; extracellular region; extracellular space; myelin sheath; nucleoplasm; vesicle

Molecular Function:chemoattractant activity; cytokine activity; dopachrome isomerase activity; hematopoietin/interferon-class (D200-domain) cytokine receptor binding; phenylpyruvate tautomerase activity; protein binding; receptor binding

Biological Process: blood coagulation; carboxylic acid metabolic process; cell aging; cell proliferation; cell surface receptor linked signal transduction; DNA damage response, signal transduction by p53 class mediator; inflammatory response; innate immune response; leukocyte migration; negative regulation of apoptosis; negative regulation of cellular protein metabolic process; negative regulation of DNA damage response, signal transduction by p53 class mediator; negative regulation of mature B cell apoptosis; negative regulation of myeloid cell apoptosis; positive chemotaxis; positive regulation of B cell proliferation; positive regulation of cytokine secretion; positive regulation of fibroblast proliferation; positive regulation of lipopolysaccharide-mediated signaling pathway; positive regulation of MAP kinase activity; positive regulation of peptidyl-serine phosphorylation; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphorylation; prostaglandin biosynthetic process; regulation of macrophage activation

Disease: Rheumatoid Arthritis, Systemic Juvenile

NCBI Summary:This gene encodes a lymphokine involved in cell-mediated immunity, immunoregulation, and inflammation. It plays a role in the regulation of macrophage function in host defense through the suppression of anti-inflammatory effects of glucocorticoids. This lymphokine and the JAB1 protein form a complex in the cytosol near the peripheral plasma membrane, which may indicate an additional role in integrin signaling pathways. [provided by RefSeq, Jul 2008]
UniProt Code:P14174
NCBI GenInfo Identifier:1170955
NCBI Gene ID:4282
NCBI Accession:P14174.4
UniProt Secondary Accession:P14174,Q2V4Y5, Q6FHV0, A5Z1R8, B2R4S3,
UniProt Related Accession:P14174
Molecular Weight:12,476 Da
NCBI Full Name:Macrophage migration inhibitory factor
NCBI Synonym Full Names:macrophage migration inhibitory factor (glycosylation-inhibiting factor)
NCBI Official Symbol:MIF��
NCBI Official Synonym Symbols:GIF; GLIF; MMIF��
NCBI Protein Information:macrophage migration inhibitory factor
UniProt Protein Name:Macrophage migration inhibitory factor
UniProt Synonym Protein Names:Glycosylation-inhibiting factor; GIF; L-dopachrome isomerase; L-dopachrome tautomerase (EC:5.3.3.12); Phenylpyruvate tautomerase
Protein Family:MIF-like protein
UniProt Gene Name:MIF��
UniProt Entry Name:MIF_HUMAN
View AllClose

0 Reviews

View AllClose

Related Products